(data stored in ACNUC7421 zone)

EMBL: CP001622.PE387

CP001622.PE387       Location/Qualifiers
FT   CDS_pept        396503..397516
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0388"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: ret:RHE_CH00697
FT                   alpha-glucoside ABC transporter, permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0388"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54699"
FT                   /db_xref="GOA:C6B1I0"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:C6B1I0"
FT                   /inference="protein motif:PFAM:PF00528"
FT                   /protein_id="ACS54699.1"
FT                   /translation="MLSQIVSALGVVVGAVIACSAYFYFSNKILDLALPVKDGDIRAAS
FT                   RNLNRRALVRPWLFIGPALFLLVVYLVYPVVATFILSFYDRAGLQFVGLANYKWALGDR
FT                   EFRQSIFNNILWLAVVPAACTFFGLVIAVMTDRIWWGNIAKSIVFMPMAISFVGASVIW
FT                   KFIYEYRGGNDVQIGLLNAIVQTFGGTPEVWISIPFWNNFFLMIILIWIQTGFAMVILS
FT                   AALRGIPEETIEAAVIDGANGWQIFWRIMVPQVWGSIAVVWTTITILVLKVFDIVLTMT
FT                   NGQWQTMVLANLMFDWMFRGGGDSGRSAVIAIIIMLAVTPIMVWNVRRANRELKGH"
     atgctgtcgc agatagtgtc cgctttgggc gtcgtggtcg gagccgttat cgcatgctcg        60
     gcctatttct atttttcgaa caagatcctg gatctcgctc tgccggtgaa ggatggtgac       120
     atccgcgccg catcgcgcaa tctcaaccgg cgtgcactcg tccggccgtg gttgttcatc       180
     ggcccggcgc tcttcctgct cgtcgtctat ctcgtctatc ccgtcgttgc gaccttcatc       240
     ctctccttct acgaccgtgc cggcctgcag ttcgtcggcc tcgccaacta caaatgggcg       300
     ctcggcgacc gcgaattccg ccagtcgatc ttcaacaaca tcctctggct cgccgtcgtg       360
     ccggccgcct gcaccttctt cggcctcgtc atcgccgtga tgaccgatcg catctggtgg       420
     ggcaatatcg ccaagagcat cgtcttcatg ccgatggcga tctccttcgt cggcgcctcg       480
     gtcatctgga aattcatcta tgaatatcgc ggcggcaacg acgtccagat cggcctgctg       540
     aacgctatcg tccagacctt cggtggtacg ccggaggtgt ggatctccat tcccttctgg       600
     aacaacttct tcttgatgat cattctgatc tggatccaga ccggtttcgc catggtcatc       660
     ctgtcggccg cccttcgcgg catccccgag gagacgatcg aagccgccgt gatcgacggc       720
     gccaatggct ggcagatctt ctggcgcatc atggtgccgc aggtctgggg ttccatcgcc       780
     gtcgtctgga cgacgatcac catcctcgtc ctcaaggtct tcgacattgt gctgaccatg       840
     accaacggcc agtggcagac gatggtgctg gcgaacctga tgttcgactg gatgttccgc       900
     ggcggcggcg attccggccg aagtgcggtc atcgccatca tcatcatgct cgctgtcacg       960
     ccgatcatgg tctggaacgt gcgccgcgcc aatcgcgaat tgaagggcca ctga            1014
//

If you have problems or comments...

PBIL Back to PBIL home page