(data stored in ACNUC7421 zone)

EMBL: CP001622.PE388

CP001622.PE388       Location/Qualifiers
FT   CDS_pept        397518..398681
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0389"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: rec:RHECIAT_CH0000777
FT                   alpha-glucoside ABC transporter, permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0389"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54700"
FT                   /db_xref="GOA:C6B1I1"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:C6B1I1"
FT                   /inference="protein motif:PFAM:PF00528"
FT                   /protein_id="ACS54700.1"
FT                   /translation="MTAIGSYFKIGPARLFVHAAVLLIVIIWLIPTLGIFVSALRDKDQ
FT                   IVVSGWWTAFVGSTQTAAVRLGTPDQQKQEGATYVISGNVLEGQTGRAVKAFGNRIQQP
FT                   AAFKAGETADLGDGETLQINSDGSYRYVKNAAFSPDQRPKRIYASVSAPPEFTMQNYNT
FT                   VLTGEGIGQSFINSLTVTIPATIIPILIAAFAAYALSWMEFPGRGLLIALVVGLIVVPL
FT                   QMSLIPLLRLYNEIGNMLGQPSKTYPGIWLAHTAFGMPLAIYLLRAYIAGLPKEIIESA
FT                   RVDGASDFEIFVRIVLPLSFPALASFAIFQFLWVWNDLLVAMVFLGTDKDHIVLTGSLN
FT                   ALLGSRGGNWEILTASAFVTIIVPLLVFFGLQRYLVRGLLAGSVKGG"
     atgaccgcta tcggaagcta cttcaagatc ggccccgccc ggctcttcgt tcacgcagcc        60
     gttctgttga tcgtcatcat ctggttgatc ccgacgctcg gcatcttcgt cagcgcgctg       120
     cgcgacaagg accagatcgt cgtctccggc tggtggacgg ccttcgtcgg ctcgacccag       180
     acggccgcgg tccgccttgg tacacccgac cagcaaaagc aggagggtgc cacctacgtc       240
     atctcgggca atgtgctgga aggccagacc ggccgcgcgg tgaaggcctt cggcaaccgc       300
     atacagcagc cggccgcctt caaggccggt gagaccgccg atctcggcga cggtgaaacc       360
     ctgcagatca acagcgacgg cagctaccgc tatgtgaaga acgccgcctt ttcgcccgac       420
     caacgcccga agcgcatcta tgcatccgtc tcggcgccgc cggaattcac gatgcagaac       480
     tacaacacgg ttctgaccgg cgagggcatc ggccaatcct tcatcaactc gctgaccgtg       540
     acgatcccgg cgacgatcat cccaatcctg attgccgctt tcgccgccta tgccctgagc       600
     tggatggagt ttcccggccg cgggctgctg atcgcgctcg tcgtcggcct catcgtcgtg       660
     ccgctgcaga tgtccctgat cccgctgctg cgcctctata acgagatcgg caacatgctc       720
     ggccagccgt ccaagaccta tcccggcatc tggctggctc ataccgcttt cggcatgccg       780
     ctcgccatct atctcttgcg ggcctatatc gccggcctgc cgaaggagat catcgaatcc       840
     gcccgcgtcg acggcgcgag cgatttcgag atcttcgtcc gcatcgtttt gcctctgtcc       900
     ttcccggcac tcgcctcctt cgccatcttc cagttcctgt gggtgtggaa cgacctgctc       960
     gtcgccatgg tcttcctcgg caccgacaag gaccacatcg tgctgaccgg cagcctgaac      1020
     gcgctgctcg gctcgcgcgg cggcaattgg gagattttga cggcgtcagc cttcgtcact      1080
     atcatcgtgc cgctgctcgt cttcttcggg cttcagcgtt acctggtgcg cggtctgctg      1140
     gcgggttcgg tcaagggagg ctga                                             1164
//

If you have problems or comments...

PBIL Back to PBIL home page