(data stored in ACNUC7421 zone)

EMBL: CP001622.PE389

CP001622.PE389       Location/Qualifiers
FT   CDS_pept        398715..400367
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0390"
FT                   /product="alpha amylase catalytic region"
FT                   /note="PFAM: alpha amylase catalytic region; SMART: alpha
FT                   amylase catalytic sub domain; KEGG: ret:RHE_CH00699
FT                   alpha-glucosidase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0390"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54701"
FT                   /db_xref="GOA:C6B1I2"
FT                   /db_xref="InterPro:IPR006047"
FT                   /db_xref="InterPro:IPR013780"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="UniProtKB/TrEMBL:C6B1I2"
FT                   /inference="protein motif:PFAM:PF00128"
FT                   /protein_id="ACS54701.1"
FT                   /translation="MNVASQSISTPDKDWWRGAVIYQIYPRSYQDSNGDGIGDLKGITA
FT                   RLPHVANLGVDAIWISPFFTSPMRDFGYDVSDYENVDSIFGTLVDFDTMIAEAHRLGIR
FT                   VMIDLVISHSSDQHPWFAQSRSSKTNAKADWYVWADAKPDGTPPNNWLSIFGGSAWAWD
FT                   PTRMQYYLHNFLTSQPDMNLHNPEVQDRLLDVVRFWLNRGVDGFRLDTINFYFHDTQLR
FT                   DNPALAPERRNASTAPAVNPYNFQEHLYDKNRPENLAFLKRFRAVLEEFPAIAAVGEVG
FT                   DSQRGLEIVGEYTSGNDKMHMCYAFEFLAPDPLTPERVEEVMQDFEAAAPDGWACWAFS
FT                   NHDVMRHVSRWGGLVADHDAFAKLYASLLMTLRGSVCLYQGEELALTEADLAYQDLQDP
FT                   YGIQFWPEFKGRDGCRTPMVWDSQVAQGGFSTVKPWLPVPVEHILRAVSVQLGDEASVL
FT                   EHYRRFIAFRKLHPAFAKGEIEFEEQQADSLVFTREYGNEKLLCIFNMSPAEAAVILPA
FT                   GEWQALTGHGFTSNNYGDKIDIPAWGAYFARLA"
     atgaacgtgg cttcccaatc gatctcgacc cctgacaaag actggtggcg cggcgcggtg        60
     atctaccaga tctacccgcg ctcctaccag gattcgaacg gtgacggcat cggcgacctg       120
     aagggcatca ccgctcgcct gccgcatgtg gcaaaccttg gcgtcgatgc gatctggatc       180
     tcgcccttct tcacctcgcc gatgcgcgat ttcggttatg acgtttccga ctacgagaat       240
     gtcgattcga tcttcggcac gctggtggat ttcgacacga tgatcgccga ggctcatcgc       300
     ctcggcatcc gcgtgatgat cgacctcgtc atctcccata gctcggatca gcatccctgg       360
     ttcgcgcaga gccgctccag caagaccaac gccaaggccg actggtatgt ctgggccgac       420
     gccaagccgg acggtacgcc gccgaacaac tggctgtcga tcttcggcgg ctcggcatgg       480
     gcgtgggatc cgacgcgcat gcaatattac cttcacaatt tcctgacctc gcagccggac       540
     atgaacctgc ataatcctga ggtgcaggac cgtctgctcg acgtcgtgcg cttctggctc       600
     aatcgcggcg tcgacggctt ccgcctcgac accatcaatt tctatttcca tgacacgcag       660
     ctgcgcgaca atccggcgct tgcccccgag cgccgcaacg cttcgacggc gccggcggtc       720
     aatccctata attttcagga gcatctctac gacaagaacc gcccggagaa ccttgccttc       780
     ctgaagcgct tccgcgccgt tctcgaggaa ttcccggcaa tcgccgccgt cggcgaagtc       840
     ggcgacagcc agcgcggcct tgaaatcgtc ggcgaataca cctccggcaa tgacaagatg       900
     cacatgtgct atgcctttga gttcctggcg cccgatccgc tgacgccgga gcgcgtcgag       960
     gaggtgatgc aggatttcga agctgccgca cccgatggct gggcctgctg ggccttctcc      1020
     aatcacgacg tcatgcgcca tgtcagccgc tggggcgggc tggtcgccga tcacgacgcc      1080
     tttgccaagc tttatgcctc gttgctgatg acgctgcgcg gctccgtctg cctctatcag      1140
     ggcgaggagc tggcgctgac cgaggccgat ctcgcctatc aggatctgca ggacccctat      1200
     ggcatccagt tctggccgga attcaagggc cgcgatggct gccgcacgcc gatggtctgg      1260
     gacagccagg tcgcccaggg cggcttctcg acggtcaagc cctggctgcc ggtgccggtc      1320
     gagcatatcc tgcgtgccgt cagcgtccag ctgggcgacg aggcttccgt gctggagcac      1380
     tatcgccgct tcatcgcttt ccgcaagctg catccggctt ttgccaaggg cgagatcgaa      1440
     ttcgaggaac aacaggccga tagcctggtc ttcacccgtg aatacggcaa cgagaagctg      1500
     ctttgcatct tcaacatgag cccggccgag gccgccgtca ttctgcctgc gggagaatgg      1560
     caggcattga cgggccacgg ctttaccagc aacaactatg gcgacaagat cgatattccg      1620
     gcctgggggg cgtatttcgc ccgtcttgcc taa                                   1653
//

If you have problems or comments...

PBIL Back to PBIL home page