(data stored in ACNUC7421 zone)

EMBL: CP001622.PE39

CP001622.PE39        Location/Qualifiers
FT   CDS_pept        35996..36424
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0040"
FT                   /product="Peptidase M15A"
FT                   /note="PFAM: Peptidase M15A; protein of unknown function
FT                   DUF882; KEGG: rec:RHECIAT_CH0000425 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0040"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54351"
FT                   /db_xref="InterPro:IPR009045"
FT                   /db_xref="InterPro:IPR010275"
FT                   /db_xref="UniProtKB/TrEMBL:C6AYC7"
FT                   /inference="protein motif:PFAM:PF08291"
FT                   /protein_id="ACS54351.1"
FT                   /translation="MQNAILLAIAGLFAFQSATGAVGQDMKRHAVHLAKHQARLAYTVQ
FT                   TVSVRAGCFPGRLRAVLSHIAAKTGRRPVITSGHRPHPRRHGSLHGKCLAADFRMPGLS
FT                   ERTIIAAARSAPGIGGIGSYCNGIIHVDVGPQRRWVDC"
     atgcagaacg caattttgct cgccatagca ggccttttcg cctttcaatc agcaacgggt        60
     gccgtcggtc aagatatgaa aaggcatgcc gttcatcttg caaaacatca ggcacgtctc       120
     gcctacacgg tccagaccgt cagcgttcgt gccggctgct ttccagggcg cctgcgagcg       180
     gtcctgtcgc atattgctgc aaagaccggc cgacgcccgg tgataacctc gggccacagg       240
     ccgcatcccc gccgccatgg ctccctgcac ggaaaatgtc tggcggccga tttcaggatg       300
     cccggcctgt cggagcgcac gatcattgct gctgcaagaa gcgcgccggg catcggcggc       360
     atcggcagct attgcaacgg catcattcat gtcgacgtcg gaccgcagcg acgatgggtg       420
     gattgctga                                                               429
//

If you have problems or comments...

PBIL Back to PBIL home page