(data stored in ACNUC7421 zone)

EMBL: CP001622.PE390

CP001622.PE390       Location/Qualifiers
FT   CDS_pept        400418..401506
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0391"
FT                   /product="ABC transporter related"
FT                   /note="PFAM: ABC transporter related; TOBE domain protein;
FT                   Transport-associated OB domain protein; SMART: AAA ATPase;
FT                   KEGG: rec:RHECIAT_CH0000779 alpha-glucoside ABC
FT                   transporter, ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0391"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54702"
FT                   /db_xref="GOA:C6B1I3"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR008995"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR040582"
FT                   /db_xref="UniProtKB/TrEMBL:C6B1I3"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /protein_id="ACS54702.1"
FT                   /translation="MTGLTLKDIRKSYGSVDVLHGIDLDIKQGEFIVFVGPSGCGKSTL
FT                   LRMIAGLEAITGGEMYIDGHLVNDVPPSKRGIAMVFQSYALYPHMTVFDNMAFGMKIAG
FT                   ESKQDIDRRVKAAAESLQLTQYLGRLPKALSGGQRQRVAIGRAICRDPKVFLFDEPLSN
FT                   LDAALRVATRIEIARLNEQMADTTMIYVTHDQVEAMTLADRIVVLSAGNIEQVGAPLDL
FT                   YERPANLFVAKFIGSPAMNIIPATVAGTGSQTTVTLTGGMSVTLDVATDASEMGKQASF
FT                   GVRPEDLRVADGADYLFEGEVSIVEALGEVTLLYIEGLVPGEPIVVKLPGIYDVKKGQR
FT                   MRFAADRQKLHLFDATGHTYRK"
     atgactggac tgacgctgaa ggatatccgc aaatcctacg gttccgtgga cgttctccac        60
     ggtatcgacc tcgatatcaa gcagggcgaa ttcatcgtct tcgtcggtcc gtccggctgt       120
     ggcaagtcca cgcttctgcg catgatcgcc ggtctcgagg cgatcaccgg cggtgagatg       180
     tatatcgatg gccatctcgt caatgacgtg ccgccctcca agcgcggcat cgccatggtc       240
     ttccagtcct atgcgctcta cccgcatatg acggtgttcg acaacatggc tttcggcatg       300
     aagatcgccg gcgaaagcaa gcaggacatc gatcgccgcg tcaaagcggc ggccgagagc       360
     ctgcagctga cccaatatct cggtcgcctg ccgaaggcgc tttccggcgg ccagcgccag       420
     cgcgtggcga tcggccgcgc catctgccgc gatcccaagg tcttcctgtt cgacgagccg       480
     ctgtccaacc tcgatgccgc gctgcgcgtc gcgacccgca tcgagatcgc ccgcctgaac       540
     gaacagatgg ccgatacgac gatgatctac gttacccacg accaggtcga ggcgatgacg       600
     ctggctgatc gcatcgtcgt tctctccgcc ggcaatatcg agcaggtcgg cgcgccgctg       660
     gacctctacg agcgcccggc aaacctcttc gtcgcgaaat tcatcggctc gccggcgatg       720
     aacatcattc cggcgacggt cgccgggact ggaagccaga cgacggtgac gctgaccggc       780
     ggcatgtcgg tgacgctgga tgtggcgacc gacgcgtcgg aaatgggcaa gcaggcaagc       840
     ttcggcgttc ggccggagga tctccgggtt gccgatggcg ccgactacct tttcgaaggg       900
     gaagtgtcga tcgtcgaagc gctcggcgaa gtgacgctgc tttatatcga gggtctggtc       960
     ccgggcgagc cgatcgtcgt caagctgccc ggcatctatg atgtgaagaa gggccagagg      1020
     atgcggtttg ccgccgacag gcagaagttg catctgtttg acgcaaccgg ccatacctac      1080
     cgaaagtga                                                              1089
//

If you have problems or comments...

PBIL Back to PBIL home page