(data stored in ACNUC7421 zone)

EMBL: CP001622.PE391

CP001622.PE391       Location/Qualifiers
FT   CDS_pept        401623..402036
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0392"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: rec:RHECIAT_CH0000780 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0392"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54703"
FT                   /db_xref="UniProtKB/TrEMBL:C6B1I4"
FT                   /inference="similar to AA sequence:KEGG:RHECIAT_CH0000780"
FT                   /protein_id="ACS54703.1"
FT                   /translation="MAASNPSQPKSHFLSKEESFMYDREARFKMEDTMNAARIEYTEKG
FT                   VMHAASRRCDIVRISMSSATLAILTQFSLPKQFYLDIPDARITKVGCLLMKVNANNTVE
FT                   VRFLRLLTQKELNKIFVYSTHPAHRDYVLDIRA"
     gtggccgctt ccaatccgtc acagccaaaa tctcatttcc tgagcaagga agaatccttc        60
     atgtatgacc gcgaggcgcg gttcaagatg gaggacacca tgaacgccgc gcgcatcgaa       120
     tatacggaaa agggcgtcat gcacgcggct tcgcgccgct gcgacattgt ccggatctcg       180
     atgagcagcg cgacgctcgc gatcctgacc cagttcagcc tgccgaagca gttctatctg       240
     gatattccgg atgcccgcat caccaaggtc ggatgcctgc tgatgaaggt caacgccaac       300
     aacacagtgg aagttcgctt cttgcgcctg ctgacgcaga aagagctgaa caagatcttc       360
     gtctacagca cccatccggc gcaccgcgac tacgttctcg atattcgagc ctga             414
//

If you have problems or comments...

PBIL Back to PBIL home page