(data stored in ACNUC7421 zone)

EMBL: CP001622.PE392

CP001622.PE392       Location/Qualifiers
FT   CDS_pept        complement(402117..403940)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0393"
FT                   /product="6-phosphogluconate dehydratase"
FT                   /EC_number="4.2.1.12"
FT                   /note="KEGG: rec:RHECIAT_CH0000783 phosphogluconate
FT                   dehydratase protein; TIGRFAM: 6-phosphogluconate
FT                   dehydratase; PFAM: dihydroxy-acid and 6-phosphogluconate
FT                   dehydratase"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0393"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54704"
FT                   /db_xref="GOA:C6B1I5"
FT                   /db_xref="InterPro:IPR000581"
FT                   /db_xref="InterPro:IPR004786"
FT                   /db_xref="InterPro:IPR020558"
FT                   /db_xref="InterPro:IPR037237"
FT                   /db_xref="InterPro:IPR042096"
FT                   /db_xref="UniProtKB/TrEMBL:C6B1I5"
FT                   /inference="protein motif:TFAM:TIGR01196"
FT                   /protein_id="ACS54704.1"
FT                   /translation="MSAHARISAITDRIVERSKPSRERYLERLRAAASKGVARSVLGCA
FT                   NLAHGFAVCSPADKDALAGDRIPNLGIITAYNDMLSAHQPFETYPAIIREAAAEAGGVA
FT                   QVAGGVPAMCDGVTQGQPGMELSLFSRDLIAMSAGVGLSHNMFDAALFLGVCDKIVPGL
FT                   VIAALSFGHLPSIFVPAGPMTTGLPNDEKSRVRQLFAEGKVGRAELLEAESKSYHGPGT
FT                   CTFYGTANSNQMLMEIMGFHMPGSSFINPGTPLREALTREAAKRALAITALGNEFTPAG
FT                   EMIDERSVVNGVVGLHATGGSTNHTLHLVAMARAAGIHLTWQDIAELSEIVPLLARVYP
FT                   NGLADVNHFQAAGGMGFLIKELLKHGLVHDDVRTVFGHGLQAYTVDARLGENGAVLREP
FT                   SPEKSVDPKVLSSIETPFQANGGLKMLRGNLGKAVIKISAVKPERHIIEAPAIIFHSQQ
FT                   ELQDAFKEGKLNRDFIAVVRFQGPKANGMPELHKLTPPLGVLQDRGFRVALLTDGRMSG
FT                   ASGKVPAAIHVTPEAVDGGPIARIREGDIIRLDAIKGTLELLVDAADLAERDPVVVDLS
FT                   DNEFGMGRELFAPFRRAVGASDQGASVLFHH"
     atgtccgctc acgcacgcat ttctgcgatc accgatcgca tcgtcgaacg ctcgaaacca        60
     agccgcgagc gctacctgga acgcctgcgc gccgccgctt ccaagggtgt cgcgcgctcg       120
     gtgcttggct gcgccaacct tgcccatggc ttcgcggtct gttcccccgc cgacaaggat       180
     gcgctcgccg gcgaccgcat ccccaatctc ggcatcatca ccgcctataa cgacatgctc       240
     tcggcccacc aaccattcga gacctatccg gcgatcatcc gcgaggcggc ggccgaggca       300
     ggcggcgtgg cgcaggtggc cggcggcgtg ccggcgatgt gcgacggcgt cacccaggga       360
     cagccgggca tggagctctc gctcttctcg cgcgacctga tcgccatgtc ggcgggcgtc       420
     ggcctgtcgc acaacatgtt cgatgccgcc ctcttcctcg gcgtctgcga caagatcgtg       480
     cccggcctgg tgatcgcggc attgtccttc ggacacctgc cgtcgatctt cgttccggcc       540
     ggtccgatga ccacaggcct gccgaacgac gagaagtcac gcgtgcgcca gctcttcgcc       600
     gagggcaagg tcggacgcgc cgagctgctg gaggcggaat cgaaatccta tcacggcccc       660
     ggcacctgca ccttctacgg caccgccaat tccaaccaga tgctgatgga gatcatgggc       720
     ttccacatgc ccggctcgtc cttcatcaat cccggcacgc cgctgcgcga agcgctgacg       780
     cgcgaagccg ccaagcgggc gctggcgatc accgcgctcg gcaacgaatt cacgccggcc       840
     ggcgagatga tcgacgaacg ctcggtcgtc aacggcgtcg tcggcttgca tgcgaccggc       900
     ggctcgacca accatacgct gcacctcgtc gccatggcgc gggcggccgg catccatctt       960
     acctggcagg acattgccga gctctcggaa atcgtcccac tgcttgcccg cgtctatccg      1020
     aacgggctcg ccgacgtgaa ccatttccag gcggccggcg gcatgggttt cctcatcaag      1080
     gaactcttga aacacggcct ggtgcatgac gacgtgcgca ccgtcttcgg ccacggtctc      1140
     caagcctata cggtcgatgc ccgcctcggc gaaaacggcg ccgtcctgcg cgagccgtcg      1200
     ccggaaaaaa gcgtcgatcc caaagtgctt tccagcatcg aaacgccgtt ccaggcgaat      1260
     ggcgggctga agatgctgcg cggcaatctc ggcaaggcgg tcatcaaaat ctccgccgtc      1320
     aagcccgagc gccacatcat cgaggccccg gcaatcatct ttcacagcca gcaggagctg      1380
     caggacgctt tcaaggaagg taagctcaac cgcgatttca tcgccgtcgt gcgcttccag      1440
     ggcccgaagg cgaacggaat gccggaactg cacaagctga cgccgccgct cggcgtgctg      1500
     caggaccgcg gcttccgcgt ggcgctgctc accgatgggc gcatgtccgg cgcatccggc      1560
     aaggtgccgg cggcgatcca cgtcacgccg gaagcggtcg atggcggtcc gatcgcccgt      1620
     attcgcgagg gcgacatcat ccgcctcgac gcgatcaagg gcacgctcga gctgctcgtc      1680
     gatgcagccg acttggccga gcgcgaccct gtcgtcgtcg atctctccga caatgaattc      1740
     ggcatgggcc gcgagctctt cgcgcccttc cgccgcgccg ttggagcttc ggaccagggt      1800
     gcgagcgtgc tcttccacca ctga                                             1824
//

If you have problems or comments...

PBIL Back to PBIL home page