(data stored in ACNUC7421 zone)

EMBL: CP001622.PE393

CP001622.PE393       Location/Qualifiers
FT   CDS_pept        complement(404018..404716)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0394"
FT                   /product="6-phosphogluconolactonase"
FT                   /note="TIGRFAM: 6-phosphogluconolactonase; KEGG:
FT                   rec:RHECIAT_CH0000784 6-phosphogluconolactonase protein;
FT                   SNP /replace=G"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0394"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54705"
FT                   /db_xref="GOA:C6B1I6"
FT                   /db_xref="InterPro:IPR005900"
FT                   /db_xref="InterPro:IPR006148"
FT                   /db_xref="InterPro:IPR037171"
FT                   /db_xref="InterPro:IPR039104"
FT                   /db_xref="UniProtKB/TrEMBL:C6B1I6"
FT                   /inference="protein motif:TFAM:TIGR01198"
FT                   /protein_id="ACS54705.1"
FT                   /translation="MASTLHSFASAADLAGSLADKVADALSAAIAARGTASIAVSGGST
FT                   PKVFFQTLSTRDVAWDKVTITLVDERFVPADNPRSNHLLVDANLLQNKAKVARFLPLYQ
FT                   DAASAEEAARLATEKTRAISSPFDIVILGMGGDGHTASFFPGGSNLAKAIDASTPRGII
FT                   TMEAEGAGEPRLTFTFSSLEDAALLVLHIEGEGKKDVLAKAEGSGDEAEMPIRAVLRRA
FT                   TSPVEIYWAP"
     atggcatcga ccctgcattc cttcgccagc gccgcagacc tcgccggcag tctcgccgac        60
     aaggtcgccg atgcgctttc ggcggcgatt gccgcccgcg gaacggcgtc catcgccgtt       120
     tccggcggct ccacgccgaa ggtcttcttc cagacgcttt cgacgcgcga cgtcgcctgg       180
     gacaaggtga cgatcacgct tgtcgacgaa cgtttcgtgc cggccgacaa tccgcgctcg       240
     aaccatctgc tggtcgatgc caatctgctg cagaacaagg caaaggtggc acgcttcctg       300
     ccgctctatc aggatgccgc ctccgcggag gaggcggcaa ggctcgcaac cgagaagacc       360
     agggcgatca gttcaccctt cgacatcgtc atcctcggca tgggtggcga tggacacacc       420
     gcctcgttct ttcccggcgg cagcaatctt gccaaggcga tcgatgcgtc gacgccgcgc       480
     ggcatcatta ccatggaagc ggaaggagcc ggcgagccgc gcctgacctt caccttctcc       540
     agtcttgagg atgccgcact cctggttctc catattgagg gcgaaggcaa aaaagacgtt       600
     ctcgccaagg cggaaggcag cggtgacgag gcagaaatgc cgatccgcgc cgttctgcgc       660
     cgggccactt ccccggtcga gatctactgg gctccctga                              699
//

If you have problems or comments...

PBIL Back to PBIL home page