(data stored in ACNUC7421 zone)

EMBL: CP001622.PE394

CP001622.PE394       Location/Qualifiers
FT   CDS_pept        complement(404727..406202)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0395"
FT                   /product="glucose-6-phosphate 1-dehydrogenase"
FT                   /EC_number="1.1.1.49"
FT                   /note="KEGG: ret:RHE_CH00704 glucose-6-phosphate
FT                   1-dehydrogenase; TIGRFAM: glucose-6-phosphate
FT                   1-dehydrogenase; PFAM: glucose-6-phosphate dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0395"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54706"
FT                   /db_xref="GOA:C6B1I7"
FT                   /db_xref="InterPro:IPR001282"
FT                   /db_xref="InterPro:IPR019796"
FT                   /db_xref="InterPro:IPR022674"
FT                   /db_xref="InterPro:IPR022675"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C6B1I7"
FT                   /inference="protein motif:TFAM:TIGR00871"
FT                   /protein_id="ACS54706.1"
FT                   /translation="MSSQIIPVEPFDYVVFGGSGDLAERKLLPALYHRQIEGQFSEPTR
FT                   VIGASRSPLTHEEYRKFAKDALNEHLKKGEYDEAEVEKFCARLYYVSVDARTDAGWDQL
FT                   KKLLDEGKDRVRAFYLAVAPGIFGDISQKIHDHKLITKSTRIVVEKPIGRDLASALQLN
FT                   DTIGRAFKEEQIFRIDHYLGKETVQNLMALRFANALYEPLWNANYIDHVQITVAESVGL
FT                   EGRAGYYDTAGALRDMVQNHILQLLCLTAMEVPSSMDSEAVRDEKLKVLRALKPLNASN
FT                   VEQATVRGQYRAGASGSGPVKGYLEELEGGVSNTETFVAIKAEINNWRWAGVPFYIRTG
FT                   KRLTGRMSEIVITFKPIPHAIFDQAAGRINANQLIIRLQPDEGVKQSLMIKDPGPGGMR
FT                   LRNVSLDMSFAQAFNVRNPDAYERLLMDVIRSNQTLFMRRDEVEAAWKWVDPILKGWET
FT                   TGQQVQGYTAGTWGPSQAIALIERDGRTWHDEI"
     atgagcagcc aaatcattcc cgttgagccc tttgattatg tcgtcttcgg cggcagcggc        60
     gaccttgcag aacgcaagct tctgcccgcg ctgtatcatc gccagatcga aggccagttc       120
     agcgaaccga cccgcgtgat cggcgcctcg cgcagcccgt tgacgcacga ggaataccgc       180
     aaattcgcca aggacgcgct gaacgagcac ctgaagaagg gtgaatatga cgaggcggag       240
     gtggagaaat tctgtgcccg cctctactac gtctcggtcg acgcccgcac ggatgccggt       300
     tgggatcagc tgaagaagct gctcgacgaa ggcaaggatc gcgtgcgcgc cttctacctc       360
     gccgtagctc cgggcatctt cggcgacatt tcgcagaaga tccacgacca caagctgatc       420
     accaagtcga cccgcatcgt cgtcgagaaa ccgatcggcc gcgacctcgc ctcggcgctg       480
     cagctcaacg acacgatcgg ccgcgccttt aaggaagagc agatcttccg tatcgaccat       540
     tatctcggca aggagacggt gcagaacctg atggcgctgc gcttcgccaa cgcgctctac       600
     gagccgctgt ggaacgccaa ctacatcgac cacgtgcaga tcacggtggc tgaatcggtc       660
     ggcctcgaag gccgcgccgg ctattacgat acggcgggcg cactgcgcga catggtgcag       720
     aaccatatcc tgcagctgct ctgcctgacg gcgatggaag taccctcgtc gatggattcg       780
     gaagccgtgc gcgacgagaa gctgaaggtg ctgcgggcgc tgaagccgct caatgcctcc       840
     aacgtcgagc aggcgacggt ccgcggccag tatcgcgccg gcgcatctgg cagcggcccg       900
     gtcaagggtt acctcgaaga gctcgaaggc ggcgtctcga acaccgagac cttcgttgcc       960
     atcaaggccg agatcaacaa ctggcgctgg gcgggcgttc ccttctatat aagaaccggc      1020
     aagcgcctga ccgggcgcat gtccgagatc gtcatcacct tcaagccgat cccgcacgcg      1080
     atcttcgacc aggcggccgg gcgcatcaac gccaaccagc tgatcatccg cctgcagccg      1140
     gatgagggcg tcaagcagtc gctgatgatc aaggatccgg gtccgggcgg catgcgcctg      1200
     cgcaacgtct cgctcgacat gagcttcgcc caggccttca acgtccgcaa tcccgacgcc      1260
     tacgagcgcc tgctgatgga cgtgatccgt tccaaccaga cattgttcat gcgccgcgac      1320
     gaagtcgaag ccgcgtggaa atgggtggat ccgatcctca agggttggga aacgaccggc      1380
     cagcaagtgc agggctatac ggccggcacc tgggggccga gccaggccat cgcgctgatc      1440
     gagcgcgacg gccgcacctg gcatgacgaa atctag                                1476
//

If you have problems or comments...

PBIL Back to PBIL home page