(data stored in ACNUC7421 zone)

EMBL: CP001622.PE395

CP001622.PE395       Location/Qualifiers
FT   CDS_pept        complement(406337..407635)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0396"
FT                   /product="FAD dependent oxidoreductase"
FT                   /note="PFAM: FAD dependent oxidoreductase; KEGG:
FT                   ret:RHE_CH00705 oxidoreductase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0396"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54707"
FT                   /db_xref="GOA:C6B1I8"
FT                   /db_xref="InterPro:IPR006076"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:C6B1I8"
FT                   /inference="protein motif:PFAM:PF01266"
FT                   /protein_id="ACS54707.1"
FT                   /translation="MASQETWQSPIAPGLSWYQATVGERPTYPALDGSRTCDVAIVGGG
FT                   YTGLQAAYNLAKSGVSVVLIEAYRFGDGASGRNGGQLGTGQRWWPEELEEKIGYERSKA
FT                   LFDLAEAAKRHLIDFAREHQIEIDYVPGQLNVAHKASYKRDYYENAEIAALRYGYPHLS
FT                   FMDEKETQERLGSKRFHCGVRDVGTGHIHPLKLLVGLARVAANAGAEIFEMTKATAIRQ
FT                   SGGKVTIETERGTITAERALIACNGHIGDLEPVTASHVMPIRSFIGATAPLDGHAGVLP
FT                   GGEAVADSRFVVRYFRKFGDGRLLFGGREAYTSDNPRDISEHIRRQIAEIYPELKDIEI
FT                   THAWGGSVGITLPRQPFVREVMPGVISIGGYSGHGVMLSNYCGKLYAETVLGTSGDLDL
FT                   FTSLDIPAFPGGARMRAPLLFLALSWFALRDKF"
     atggcatcgc aggagacgtg gcagagcccg atcgcgcccg ggctgtcctg gtatcaggca        60
     accgtcgggg agcggcccac ctaccccgct ctcgacggct cgagaacatg tgacgtcgca       120
     attgtcggcg gcggctatac cggcctgcag gccgcctata atcttgccaa gtcaggcgtt       180
     tcggtggtcc ttatcgaggc ctaccgcttc ggcgacgggg cgtccgggcg caatggcggc       240
     caactcggca ccggtcagcg atggtggccg gaagaactcg aggagaagat cggctacgaa       300
     cgctcgaagg cgctgttcga tcttgccgaa gcggccaagc gccatctcat cgatttcgcc       360
     cgcgagcatc agatcgagat cgactatgtg cccggccagc tcaacgtcgc acacaaggcg       420
     agctacaaac gcgactatta cgaaaatgcc gaaatcgccg ccttacggta cggctatccg       480
     catctaagct ttatggacga gaaggaaacg caggagaggc tcggttcgaa gcgtttccat       540
     tgcggtgtgc gcgatgtcgg caccggccac atccatccgc tgaaactgct ggtcgggctg       600
     gcgcgggtcg ccgcaaatgc cggcgctgaa atcttcgaga tgaccaaggc aacggcgatc       660
     cgccaaagcg gcggcaaggt gacgatcgaa accgaaaggg gaacgatcac cgccgagcgc       720
     gcactgatcg cctgcaacgg tcatatcggc gaccttgaac cggtaacggc gagccatgtc       780
     atgccgatcc gctccttcat cggcgccacg gcgccgctcg acgggcatgc cggtgtgctt       840
     cccgggggcg aggccgtggc cgattcgcgc ttcgtcgtgc gctacttccg caaattcggc       900
     gatggccgcc tgctgttcgg cggacgcgaa gcctatacct cggacaatcc gcgcgacatt       960
     tcagagcaca tccgccggca gatcgccgag atctatccag agctgaagga catcgagatc      1020
     acccatgcct ggggcggcag cgtcggcatc accctgccgc gccagccctt cgtgcgcgag      1080
     gtcatgcccg gcgtcatctc gatcggcggt tattccggcc atggcgtcat gctgtcaaac      1140
     tactgtggca agctctatgc ggaaacggtg cttggaacat ccggcgatct cgatctcttc      1200
     acatcgctcg atattcccgc ctttcccggc ggagcccgga tgcgcgcgcc gttgcttttc      1260
     ctcgccttgt cgtggtttgc acttcgcgac aagttttag                             1299
//

If you have problems or comments...

PBIL Back to PBIL home page