(data stored in ACNUC7421 zone)

EMBL: CP001622.PE396

CP001622.PE396       Location/Qualifiers
FT   CDS_pept        complement(407648..409084)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0397"
FT                   /product="Glutamate--putrescine ligase"
FT                   /EC_number="6.3.1.11"
FT                   /note="PFAM: glutamine synthetase catalytic region; KEGG:
FT                   ret:RHE_CH00706 glutamine synthetase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0397"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54708"
FT                   /db_xref="GOA:C6B1I9"
FT                   /db_xref="InterPro:IPR008146"
FT                   /db_xref="InterPro:IPR014746"
FT                   /db_xref="InterPro:IPR027303"
FT                   /db_xref="InterPro:IPR036651"
FT                   /db_xref="UniProtKB/TrEMBL:C6B1I9"
FT                   /inference="protein motif:PRIAM:6.3.1.11"
FT                   /protein_id="ACS54708.1"
FT                   /translation="MSPKKTTLKPARNVPASKKTPPEPGSLRGVANWKEAARWLRARGI
FT                   EDIECITPDLAGVARGKMMPSSKFTSNTSLALPSAIYRHTISGEYPDETESFRYEPRDS
FT                   DLKLMPDLSTLSVVPWETDPTAQVICDIVDSDGGEVPYTPRNVLKRIMSLYHERGWKPI
FT                   VAPEIEFYLVAKNDDPDYPLHPPKGRSGRSILGGQGYSIAGINEFDELIDDVYHFSEKQ
FT                   GLEIDTLIHEEGPAQMEINLRHGNPIELADQVFLFKRTIREAALKHDIYATFMAKPMQG
FT                   QPGSAMHIHQSVVDIETGKNIFSNADGSASKEFFHFIGGMQKFVPSAMAMLAPYVNSYR
FT                   RLQPDMSCPVNNAWGYDNRTTAFRVPVSDPQARRVENRLPSSDANPYLALAASLASGLL
FT                   GIMKQIEPTAPTEDSANEGSIDLPRGLLEAVALLEDEPAFEEMFGKQFIGLYAGVKRGE
FT                   FETFMQVISPWEREFLLLNV"
     atgtccccaa aaaagacgac gctgaagcct gccagaaacg tacccgcctc gaagaaaact        60
     cccccggaac ccggatccct gcgtggcgtt gcgaactgga aggaagcagc gcggtggctg       120
     agggcgagag gcatcgaaga catcgaatgc atcacgccgg accttgccgg cgttgcgcgc       180
     ggcaagatga tgccgagctc gaaattcacc tccaacacct cgctggcgct gccttcggcc       240
     atctaccggc acacgatttc gggcgaatat cccgacgaga cggagagctt ccgctatgag       300
     ccgcgcgaca gcgacctgaa gctgatgccc gacctttcga cgctgtccgt cgtgccctgg       360
     gagaccgacc cgacggcgca ggtgatctgc gatatcgtcg attcggacgg cggcgaagtg       420
     ccctatacgc cgcgcaacgt gctgaagcgg atcatgagcc tctatcatga gcgcggctgg       480
     aaaccgatcg tggcgcccga gatcgaattc tatctcgtcg ccaaaaacga cgatcccgac       540
     tatccgctcc acccgcccaa aggccggtcc ggccgctcga tcctcggcgg ccagggctat       600
     tcgatcgccg gcatcaacga gttcgacgaa ctgatcgacg acgtctatca tttctcggag       660
     aagcaggggc tggagatcga tacgctgatc catgaagagg gaccggcgca gatggagatc       720
     aacctgcgcc acggcaatcc gatcgaactt gccgaccagg tattcctgtt caagcggacg       780
     atccgcgagg cggcactgaa acacgacatc tatgcgacct tcatggccaa gccgatgcag       840
     ggccagccgg gttcggcgat gcatatccac cagtcggtgg tcgatatcga gaccggcaag       900
     aacatcttct ccaatgccga tggctcggct tcgaaggaat tcttccattt catcggcggc       960
     atgcagaaat tcgtgccgag cgcgatggcg atgctggcgc cttacgtgaa ttcctaccga      1020
     cgcctgcagc ccgatatgtc ctgcccggtc aacaatgcct ggggttacga caaccggacg      1080
     accgccttcc gtgtcccggt ctccgatccg caggcgcggc gcgtggaaaa ccggctgccg      1140
     agctcggacg ccaaccccta tctcgcgctc gccgcctcgc tcgcctccgg cctgctcggc      1200
     atcatgaagc agatcgagcc gacggcgccg accgaggatt cggccaatga gggatcgatc      1260
     gacctgccgc gcggcctgct ggaagccgtg gcgctgctcg aggacgaacc cgctttcgag      1320
     gagatgttcg gcaagcagtt catcggcctt tatgccggcg tcaagcgcgg cgagttcgag      1380
     accttcatgc aggtgatcag cccctgggag cgggaattcc ttctgctcaa cgtgtga         1437
//

If you have problems or comments...

PBIL Back to PBIL home page