(data stored in ACNUC7421 zone)

EMBL: CP001622.PE397

CP001622.PE397       Location/Qualifiers
FT   CDS_pept        409173..410393
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0398"
FT                   /product="HI0933 family protein"
FT                   /note="PFAM: HI0933 family protein; FAD dependent
FT                   oxidoreductase; FAD-dependent pyridine
FT                   nucleotide-disulphide oxidoreductase; fumarate
FT                   reductase/succinate dehydrogenase flavoprotein domain
FT                   protein; KEGG: rec:RHECIAT_CH0000788 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0398"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54709"
FT                   /db_xref="InterPro:IPR004792"
FT                   /db_xref="InterPro:IPR023166"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:C6B1J0"
FT                   /inference="protein motif:PFAM:PF03486"
FT                   /protein_id="ACS54709.1"
FT                   /translation="MEKEDAGLIGETGLQRKSDVIVIGAGAAGMMAAIRAGKRGRSVVI
FT                   LDHARAPGEKIRISGGGRCNFTNIHAGPKNFLSANPHFCKSALARFTPADFIAMVDRHG
FT                   ITWHEKTLGQLFCDDSAKDIIRMLLAEMRAAGATLHLGTEISGVEKTESGFRVSTSEGH
FT                   CEASSLIVATGGKSIPKMGATGFAYRLAEQFGLAVLETRPGLVPLTLDPGLLESIAPLA
FT                   GIAAPAEIRHGRTGFREALLFTHRGLSGPAILQISSYWREGDEIVLAIEPDIDIAAHLK
FT                   VAKQLNGRQSPQTALGDILPKRLAQFLVEREKISGNMADLPDKALLRLAAGVQNWAVKP
FT                   SGSEGYRTAEVTLGGIDTAALDSRSMEAKAVPGLYFIGECVDVTGWLGGYNFQWAWASG
FT                   FAAGECV"
     atggaaaaag aagacgcggg tttgatcggg gaaacgggtt tgcagcgcaa aagcgacgtt        60
     atcgtcatcg gcgccggagc ggcgggcatg atggccgcca tccgcgccgg aaaacgcggc       120
     cgctcggtcg tcatcctcga ccatgccagg gcgcctggcg agaagatccg catatcaggc       180
     ggcggccgct gcaatttcac caatatccat gccggaccga agaatttcct ctccgccaac       240
     ccgcatttct gcaagtcggc gcttgcccgt ttcacgcccg ccgatttcat cgccatggtc       300
     gaccgtcatg gcattacatg gcacgaaaag acgctcggcc agcttttctg cgacgatagc       360
     gccaaagaca tcatccgtat gctgttggcg gagatgcgcg cggccggtgc aacgctgcat       420
     cttggcaccg agatatcagg cgtcgaaaag accgaatccg gcttccgggt atcgacgagc       480
     gaaggtcact gtgaagcatc gtcgctgatc gtcgccaccg gcggcaagtc gatcccgaag       540
     atgggcgcca ccggctttgc ctatcgcctc gccgagcagt tcggcttggc cgtgctcgaa       600
     acccgacccg gcctcgtgcc gctgacgctc gatcccggcc tgctggaaag catcgcgccg       660
     ctcgccggca ttgccgcccc ggccgaaatc cgccacggca ggaccggctt ccgcgaagcg       720
     ctgctgttca cccatcgcgg gctcagcggc ccggccatcc tgcagatttc ctcctattgg       780
     cgcgagggcg acgagatcgt gctcgccatc gaaccggata tcgatattgc cgcccatctg       840
     aaggtggcaa agcagctcaa tggccgtcag tcgccgcaga cggcactcgg cgatatcctg       900
     ccgaagcggc tggcacaatt tctcgtcgag cgcgagaaaa tctccggcaa catggccgac       960
     ctgcccgaca aggcgctgct gcgtcttgcc gccggcgtcc agaactgggc agtcaaaccc      1020
     tccggctcgg agggctaccg caccgccgaa gtgacgcttg gcggcatcga cacggcagcg      1080
     ctcgattccc gcagcatgga agcaaaagcc gtgcccggcc tttatttcat cggcgaatgc      1140
     gtcgacgtca ccggctggct cggcggctat aatttccagt gggcctgggc ttccggtttt      1200
     gccgcgggcg aatgcgtcta a                                                1221
//

If you have problems or comments...

PBIL Back to PBIL home page