(data stored in ACNUC7421 zone)

EMBL: CP001622.PE399

CP001622.PE399       Location/Qualifiers
FT   CDS_pept        411095..413626
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0400"
FT                   /product="methyl-accepting chemotaxis sensory transducer"
FT                   /note="PFAM: chemotaxis sensory transducer; histidine
FT                   kinase HAMP region domain protein; SMART: chemotaxis
FT                   sensory transducer; histidine kinase HAMP region domain
FT                   protein; KEGG: rec:RHECIAT_CH0000790 methyl-accepting
FT                   chemotaxis protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0400"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54711"
FT                   /db_xref="GOA:C6B1J2"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR004089"
FT                   /db_xref="UniProtKB/TrEMBL:C6B1J2"
FT                   /inference="protein motif:PFAM:PF00015"
FT                   /protein_id="ACS54711.1"
FT                   /translation="MLIDKILSRFRIKTKVLIFVLPFVVTISAVGLTGLYASGLLQGRM
FT                   EISNSVLQSLSGFKDLYGSMDDFLRVTSPEARDKLSADLKIQQGVLDQTLSQVGDEAAG
FT                   RDSLAEASRRTKEISGVVDKLWALHEQEQALHEQIDAAQKSVISTRFTVSYQAEQLQST
FT                   VQSDESAATSTLRTADRLLKGGDFLGTVASGFSKPQTPQDKIAFINEQMPEIIKSQRLI
FT                   AISVPSNQKNVIEALAATIDGIKAIVQTPNPTDETATELGRLVSRFRQTSTYTQLTATQ
FT                   KMRDATQEFAALDGRIAQANSVLQDTRRLENSVYSLQIVLSDFLADSSKENLVRLQQQA
FT                   GTLGKDMQVLVTSAKGMGFAEGISGAIQPALDVISGGGSKIVDTIGERVTAYAAARQEL
FT                   DQIWKKLTDFAELQKQTAGTERTQANSISVMTTGLGILLSILGGIALVLTLQRPISHIT
FT                   AAMRRIAEGALDTSISGEQRHDEIGDMARALGIFKENAISKIRIEEQSDEERAAAEHER
FT                   LRNDAEKREMDRQIEFAVNALAAGLERMSQGDISTTIETPFIGRLEQLRQDFNGSMMRL
FT                   QATMSQIRDNVELIQGNGNQMAQSAEDLSKRTEQQAASLEETAAAVDQITVTVRSSAER
FT                   AKDADQIVRQAKRSADDSAVVVSNAIDAMSRIEGASRQIEQIIGVIDEIAFQTNLLALN
FT                   AGIEAARAGEAGKGFAVVAMEVRELAQRSAAAAQEIKGLINKSTNEVNSGSQFVQETGT
FT                   VLAKISAQIVTISQHVEMIARASHDQSNALQSVNATVNQMDQMTQQNAAMVEETTAASR
FT                   ELADEAGSLRRLIQQFKIDGEATSAPVYRAA"
     atgttgattg acaagattct ttcccgcttc aggatcaaga ccaaggttct gatcttcgtt        60
     ctgcctttcg tcgtcaccat ttcggcggtg ggcctgaccg gcctctacgc ttcgggacta       120
     ctgcagggcc gcatggaaat atccaacagc gtgctgcagt cgctcagcgg cttcaaggat       180
     ctctatggtt cgatggatga tttcctgcgc gtcaccagcc ctgaggcgcg tgacaaactg       240
     agcgcggatc tgaagatcca gcaaggcgtg ctcgaccaga cgctgagcca ggtcggtgac       300
     gaagccgctg gccgtgacag ccttgcggag gcatcgcgcc gcaccaagga aatttcgggc       360
     gtcgtcgaca agctctgggc cctgcacgag caggaacagg cattgcatga gcagatcgac       420
     gcggcccaga aaagcgtgat cagcacccgt ttcaccgtgt cctaccaggc cgagcagttg       480
     cagagcaccg tccagagcga cgagagcgcc gccaccagca cccttcgcac ggccgaccgc       540
     ctgctgaagg gcggcgattt cctcggcacc gtcgccagcg gcttcagcaa gccgcagaca       600
     ccgcaggaca agatcgcctt catcaacgaa cagatgccgg agatcatcaa atcgcagcgt       660
     ctgatcgcca tctcggttcc gagcaatcag aagaatgtca tcgaggcact ggctgcgacc       720
     atcgacggca tcaaggcgat cgtccagacg cccaatccga ccgacgagac cgccaccgaa       780
     ctcggccgcc ttgtttcgcg cttccgccag acctcgacct atacgcagct gaccgcaacg       840
     cagaagatgc gtgacgcgac ccaggaattc gcggcgctcg acggccggat cgcccaggcc       900
     aactcggtcc tgcaggatac gaggcgcctc gaaaattccg tctattcgct gcagatcgtt       960
     ctttccgact ttctcgccga ctccagcaag gaaaatctcg tgcgtctgca gcagcaggcc      1020
     ggcacgctcg gcaaggacat gcaggtgctg gtcaccagcg ccaagggcat gggctttgcc      1080
     gaaggtatat ccggcgcgat ccagccggcg ctcgacgtca tctccggcgg cggctcgaag      1140
     atcgtcgaca cgatcggcga gcgcgtcacg gcctatgccg ccgcccgcca ggagctcgac      1200
     cagatctgga aaaagctgac cgatttcgcc gaactgcaga agcagacggc cggcaccgag      1260
     cgcactcagg caaacagcat ttccgtcatg accaccggtc tcggcatcct gctgtcgatc      1320
     ctcggcggta ttgccctggt gctgacgctg cagcgcccga tcagccatat caccgccgcc      1380
     atgcgccgca tcgccgaagg ggcgctggac accagcatct ccggcgagca gcgccacgat      1440
     gaaatcggcg acatggcccg cgcgctcggc atcttcaagg aaaatgccat ctcgaagatc      1500
     cgcatcgagg agcagagcga cgaggaacgc gccgccgccg aacatgagcg cctgcgcaac      1560
     gacgccgaaa agcgcgagat ggatcgccag atcgaattcg cggtcaacgc gctcgccgcc      1620
     ggcctcgaac gcatgtcgca gggcgatatc tcaacgacga tcgaaacgcc tttcatcggc      1680
     cgcctcgaac agctgcgcca ggatttcaac ggttcgatga tgcgactgca ggcgacgatg      1740
     agccagatcc gcgacaatgt cgaattgatc cagggcaacg gcaatcagat ggcccagtcg      1800
     gccgaggatc tctccaagcg cactgaacag caggctgcct cgctcgaaga gaccgcggct      1860
     gccgtcgatc agatcaccgt caccgtccgc tcgtcggccg aacgcgccaa ggatgccgac      1920
     cagatcgtcc gccaggccaa gcgcagcgcc gacgattccg ccgtcgtcgt cagcaatgcg      1980
     atcgacgcga tgagccgcat cgaaggtgcc tcgcgccaga tcgagcagat catcggcgtc      2040
     atcgacgaga tcgccttcca gaccaacctc ctggcgctca acgccggcat cgaggcggcg      2100
     cgcgccggtg aggccggtaa aggcttcgcg gtggtcgcga tggaagtccg cgaactggcc      2160
     cagcgctccg cagccgcggc gcaggagatc aaggggttga tcaacaaatc gaccaacgag      2220
     gtcaattccg gctcgcaatt cgtgcaggag actggcacgg tgctcgccaa gatcagcgcc      2280
     cagatcgtca cgatcagcca gcatgtcgag atgatcgctc gcgccagcca cgaccagtcc      2340
     aacgcgctgc agagcgtcaa cgcgacggtc aaccagatgg accagatgac gcagcagaac      2400
     gccgccatgg tggaggaaac gactgccgcc agccgcgaac tggccgacga ggccggttcg      2460
     ctgcgccggc tcattcagca gttcaagatc gacggcgaag ccaccagtgc gccggtctat      2520
     cgcgccgcct ga                                                          2532
//

If you have problems or comments...

PBIL Back to PBIL home page