(data stored in ACNUC7421 zone)

EMBL: CP001622.PE4

CP001622.PE4         Location/Qualifiers
FT   CDS_pept        complement(4105..4749)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0004"
FT                   /product="non-canonical purine NTP pyrophosphatase,
FT                   rdgB/HAM1 family"
FT                   /note="TIGRFAM: non-canonical purine NTP pyrophosphatase,
FT                   rdgB/HAM1 family; PFAM: Ham1 family protein; KEGG:
FT                   rec:RHECIAT_CH0000400 probable nucleoside-triphosphatase
FT                   protein, HAM1-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0004"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54316"
FT                   /db_xref="GOA:C6AY92"
FT                   /db_xref="InterPro:IPR002637"
FT                   /db_xref="InterPro:IPR020922"
FT                   /db_xref="InterPro:IPR029001"
FT                   /db_xref="UniProtKB/TrEMBL:C6AY92"
FT                   /inference="protein motif:TFAM:TIGR00042"
FT                   /protein_id="ACS54316.1"
FT                   /translation="MRKLETKTIVVASHNAGKIREIQELIGPLGFTAKSAAELNFVEPD
FT                   ETGTSFEENATIKAVASANASGMPALSDDSGLVVDALGGDPGVYTANWAEKADGTRDFD
FT                   MAMAKVEKALQDAGATKPEQRTARFISVLCLAWPDGHTELFRGEVEGSVVWPPRGTQGF
FT                   GYDPVFQPEGYDITFGEMSGEEKHGWNVGKPQALSHRARAFKLFVETCLEA"
     atgcgcaagc ttgaaacgaa gaccatcgtc gttgccagcc acaatgccgg caagatccgc        60
     gagatccagg aattgatcgg gccgctcggc ttcaccgcca aatcggccgc cgagctgaat       120
     ttcgtcgagc cggatgagac cggcacgagc ttcgaggaga atgcgacgat caaggcagtc       180
     gcctcggcca atgcctcagg catgccggcg ctgtcggacg attccgggct ggtggtcgat       240
     gcactcggcg gcgatcccgg tgtctacacc gccaattggg cggagaaggc cgacggcacg       300
     cgcgatttcg acatggcgat ggccaaggtg gaaaaggcgc tgcaggatgc gggcgcgaca       360
     aagccggaac agcgcacggc gcgtttcatc agcgtgctct gccttgcctg gccggacggg       420
     catacagagc tgtttcgcgg cgaggtggaa ggcagtgtcg tctggccgcc gcgcggcacc       480
     cagggcttcg gttacgatcc ggtcttccag cccgagggct acgacatcac cttcggcgaa       540
     atgagcggcg aggaaaaaca cggctggaac gtcggcaagc cgcaagcgct gtcgcaccgt       600
     gcccgcgcct tcaaactctt tgttgaaacc tgcctggagg cataa                       645
//

If you have problems or comments...

PBIL Back to PBIL home page