(data stored in ACNUC7421 zone)

EMBL: CP001622.PE40

CP001622.PE40        Location/Qualifiers
FT   CDS_pept        complement(36507..37127)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0041"
FT                   /product="transcriptional regulator, TetR family"
FT                   /note="PFAM: regulatory protein TetR; KEGG: mes:Meso_3334
FT                   transcriptional regulator, TetR family"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0041"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54352"
FT                   /db_xref="GOA:C6AYC8"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="UniProtKB/TrEMBL:C6AYC8"
FT                   /inference="protein motif:PFAM:PF00440"
FT                   /protein_id="ACS54352.1"
FT                   /translation="MVTKCQSVQMTQNDRKIAQILDAALPVFVRFGFRKTSMADIARAA
FT                   GISRASLYLSFNSKEELFRAGSMRAHTLALDEVGAALAGQGNALDRMEMAIAVFQRELI
FT                   APFGGSSDAEELFAANMALAADITLDARTRLSTMLTQTLNAAAETKEIDLGPLQASPLQ
FT                   LANIMMAAMDGIKHAQWNGSSLDDDTKLFMRLLRVAVTPRSGQ"
     atggtcacga aatgccagtc tgtccaaatg acgcagaatg atcgaaaaat cgctcaaatc        60
     ctggatgctg ccctgcctgt gttcgtgcgc ttcggctttc gcaagacttc catggccgac       120
     attgcgcgcg ccgcaggaat ttcgcgagca tcgctctatc tgagcttcaa cagcaaggaa       180
     gagcttttcc gagccggctc catgcgagcg catactctcg cattggatga ggtgggagcg       240
     gccctggcag gacaggggaa cgcgcttgac cgcatggaaa tggccatagc agtgtttcag       300
     cgggagttaa tcgccccttt tggcggcagt tccgatgcag aagaactgtt tgccgccaat       360
     atggccttgg ctgcggatat cacgctcgac gcgcggacac ggctatcgac tatgctgaca       420
     cagacgctga atgcagctgc ggaaaccaag gaaatcgatc tcggaccact gcaggcctcg       480
     cctcttcaac tggccaatat catgatggct gcaatggatg ggatcaaaca cgcgcaatgg       540
     aatggttcca gcctcgatga cgatacaaaa ctattcatgc gcctcttgcg ggtggcggtg       600
     acgccgcgga gcggccaata g                                                 621
//

If you have problems or comments...

PBIL Back to PBIL home page