(data stored in ACNUC7421 zone)

EMBL: CP001622.PE400

CP001622.PE400       Location/Qualifiers
FT   CDS_pept        413858..415705
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0401"
FT                   /product="methyl-accepting chemotaxis sensory transducer"
FT                   /note="PFAM: chemotaxis sensory transducer; histidine
FT                   kinase HAMP region domain protein; SMART: chemotaxis
FT                   sensory transducer; histidine kinase HAMP region domain
FT                   protein; KEGG: ret:RHE_CH00709 methyl-accepting chemotaxis
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0401"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54712"
FT                   /db_xref="GOA:C6B1J3"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR004089"
FT                   /db_xref="InterPro:IPR029151"
FT                   /db_xref="InterPro:IPR033462"
FT                   /db_xref="UniProtKB/TrEMBL:C6B1J3"
FT                   /inference="protein motif:PFAM:PF00015"
FT                   /protein_id="ACS54712.1"
FT                   /translation="MLRLFSTSIVRQIVAITLFLLAISTAAIVGVTYYNLSHQVMDGAV
FT                   SDANDAARAMAVLYGAADQAAKIELKDNQLFAVTEDAIPALADHSLVDRTAQSIAGVAT
FT                   IFQKQGGDYVRISTNVKKENGDRAVGTKLIAEHPAQPVLARGEAYYGPAELFGRKFMTG
FT                   YFPMKNASNANVGILFIGIPMEVYYQRMYELQMLVLGVGAIVMLIVGVLAFYAIRLSVK
FT                   PLQALTASVHSISAGDLEGAIPCVEKKNEFGDIGRALALFSDSARARRDLETQAAEQRE
FT                   LSDAERARNDADKRSLDGQIDFAVNQLAAGLGRLSQGDVSQTIGTPFVGRLEQLRVDFN
FT                   ASLLRLQDTLSGIRDSASTIQRNSGAVSVSAGELSKRTEAQAANLEETAAAVEEITVTV
FT                   RSSAERAREANNVVAATKKTADSSGAVVGDAVAAMDRIEQASQRIEQIIEVIDDIAFQT
FT                   NLLALNAGIEAARAGEAGKGFAVVAQEVRELAQRSADAAREIKSLIETSSREVTAGSEL
FT                   VQKTGSVLASISQEIIAISGHVETIATASRDQSAALQEVNGSVNAMDQMTQKNAAMVAE
FT                   TTQASRLLAGEADTLMALIERFRIVAESAPAHLGARRVA"
     atgctgcgcc tattctctac gtcgatcgta cgccagatcg ttgcgatcac gctgtttctg        60
     ctggcgatca gcacggccgc catcgttggc gtgacctatt acaatttgag ccatcaggtc       120
     atggacgggg ccgtctccga tgcgaatgac gccgcccgtg cgatggctgt cctctacggc       180
     gcggctgatc aggctgcaaa gatcgaactg aaggacaatc agctcttcgc cgtcaccgaa       240
     gacgccatcc cggcccttgc cgatcattcg ctggtcgacc gcaccgcgca gtcgatcgct       300
     ggtgtcgcga ccatcttcca aaagcagggc ggcgactacg tccgcatatc caccaacgtc       360
     aagaaggaaa acggcgaccg cgccgtcggc accaagctga tagccgagca cccggcccag       420
     ccggttctcg ccaggggtga ggcttattac ggtccggcgg agcttttcgg ccgcaagttc       480
     atgaccggtt atttccccat gaagaatgcc tcgaacgcca atgtcggcat tctcttcatc       540
     ggcattccga tggaggtcta ttaccagcgc atgtatgagc tgcagatgct ggttctcggt       600
     gtcggcgcca tcgtcatgct catcgtcggc gttctcgcct tttatgcgat ccgcctgtcg       660
     gtgaagccct tgcaggcgct gacagcgagc gtgcactcga tttccgcggg cgatctcgaa       720
     ggggcgatcc cctgtgtcga aaagaagaac gagttcggcg acatcggccg ggccttggcg       780
     cttttcagcg acagtgcccg cgcaaggcgc gacctggaaa cccaggctgc cgaacagcgc       840
     gaattgagcg atgccgaacg ggccaggaac gatgccgaca agcgctcgct cgacggccag       900
     atcgactttg ccgtcaacca gcttgccgcc ggcctcgggc gcctgtcgca gggcgatgtc       960
     tcgcagacga tcggtacgcc cttcgttggc cggctggagc agctgcgcgt cgatttcaac      1020
     gcttccctct tgcggctcca ggatacgctg tccggtatcc gtgacagcgc ttcgacgatc      1080
     cagcgcaaca gcggcgccgt ctccgtctct gccggcgagc tttcgaaacg caccgaggcg      1140
     caggcggcga acctcgagga gactgcggcc gcggtggaag agatcaccgt gaccgttcgt      1200
     tcgtccgccg agcgtgcccg tgaagccaac aatgtcgtgg ctgcgaccaa gaagacggcc      1260
     gacagttccg gcgccgtcgt cggcgatgcc gttgctgcca tggatcgcat cgagcaggca      1320
     tcacagcgta tcgagcagat catcgaggtg atcgacgaca tcgccttcca gaccaatctt      1380
     ctggcgctga atgccggcat cgaggcggcg cgcgccggcg aggcgggcaa gggttttgcc      1440
     gtcgtcgccc aggaagtccg cgaactcgcc cagcgctcgg ccgatgcggc acgcgagatc      1500
     aagtcgctca tcgagacgtc gagccgcgaa gtgacggcag gctccgaact ggtccagaag      1560
     accggcagcg tccttgcctc gatcagccag gagatcatcg cgatcagcgg ccatgtcgag      1620
     accatcgcca ccgccagccg cgatcagtcg gccgcgctgc aggaagtcaa cggttcggtc      1680
     aacgccatgg atcagatgac ccagaagaac gcggcgatgg ttgccgagac gacgcaggca      1740
     agccgcctgc ttgccggcga agccgatacg ctgatggcgc tgatcgagcg cttccgcatc      1800
     gtcgcagaat cggcaccggc tcatctcgga gcaagaagag tcgcctga                   1848
//

If you have problems or comments...

PBIL Back to PBIL home page