(data stored in ACNUC7421 zone)

EMBL: CP001622.PE404

CP001622.PE404       Location/Qualifiers
FT   CDS_pept        complement(417271..418560)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0405"
FT                   /product="isocitrate lyase"
FT                   /note="TIGRFAM: isocitrate lyase; PFAM: isocitrate lyase
FT                   and phosphorylmutase; KEGG: ret:RHE_CH00712 isocitrate
FT                   lyase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0405"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54716"
FT                   /db_xref="GOA:C6B1J7"
FT                   /db_xref="InterPro:IPR006254"
FT                   /db_xref="InterPro:IPR015813"
FT                   /db_xref="InterPro:IPR018523"
FT                   /db_xref="InterPro:IPR039556"
FT                   /db_xref="InterPro:IPR040442"
FT                   /db_xref="UniProtKB/TrEMBL:C6B1J7"
FT                   /inference="protein motif:TFAM:TIGR01346"
FT                   /protein_id="ACS54716.1"
FT                   /translation="MTDFYKLVPNALADRFDGIERPYSAEDVQRLRGSVALSHTLAAMG
FT                   ADRLWQLLHQEDFVNALGALSGNQAMQMVRAGLKAIYLSGWQVAADANTASAMYPDQSL
FT                   YPANAGPELAKRINRTLQRADQIETAEAQGLSVETWFAPIVADAEAGFGGPLNAFEIMK
FT                   AYIEAGAAGVHFEDQLASEKKCGHLGGKVLIPTAAHIRNLDAARLAADVMGVATLVIAR
FT                   TDAEAAKLLTSDIDERDQPFVDYDAGRTVEGFYQVRNGIEPCIARAVAYAPHCDLIWCE
FT                   TSKPDLDQARRFAEGVHKVHPGKLLAYNCSPSFNWKKNLDEATIARFQRELGAMGYKFQ
FT                   FITLAGFHQLNYGMYELARGYRQRQMSAYSELQQAEFAAEVNGYTATKHQREVGTGYFD
FT                   AVSLAITGGRSSTTAMHGSTEHAQFKPAAE"
     atgacggatt tttacaagct tgtcccaaac gctttagccg atcgcttcga cggcatcgag        60
     agaccgtact cggccgaaga cgtgcagcgg ctcagaggct cggtggcgct cagccatacg       120
     ctggccgcaa tgggggcgga tcggttgtgg cagcttctgc atcaggagga tttcgtcaat       180
     gcgctcggcg cactttccgg caaccaggct atgcagatgg tgcgcgccgg gctgaaggcg       240
     atctatctct ccggctggca ggtggcggcc gacgccaata cggcatctgc gatgtatccc       300
     gaccagtccc tctatccggc caatgccggt ccggaactgg ccaaacgcat caaccgcacg       360
     ctgcagcgcg ccgatcagat cgagaccgcg gaagcccagg ggctttccgt cgagacctgg       420
     ttcgcgccga tcgttgccga tgcggaagca ggcttcggcg gaccgctcaa cgccttcgaa       480
     atcatgaagg cctatatcga ggcgggtgcc gcgggcgttc acttcgagga ccagctcgct       540
     tcggagaaga aatgcggcca tctcggcggc aaagtgctga tcccgacggc cgcccatatc       600
     cgcaatctcg acgccgcgcg gcttgccgcc gacgtcatgg gcgttgcgac gctggtcatc       660
     gcccgcaccg acgcggaagc ggcaaagctc ttgacgtcgg acatcgacga acgcgaccaa       720
     cccttcgtcg actatgatgc cggccgtacg gtcgaaggtt tctatcaggt gcgaaacggc       780
     atcgagccct gtatcgcgcg cgccgtcgcc tatgcgccgc attgcgatct catctggtgc       840
     gagacctcga agccggacct cgatcaggcg cgccgctttg ccgaaggcgt gcacaaggtc       900
     catcccggca agctgctcgc ctataattgc tcaccttcct tcaactggaa gaagaatctc       960
     gacgaggcga cgatcgcacg gttccagcgc gaactcggag cgatgggcta caaattccag      1020
     ttcatcacgc tcgccggctt ccaccagctg aactacggca tgtacgagct ggcgcgcggc      1080
     taccggcagc ggcagatgtc ggcctattcc gagctgcagc aggcggaatt cgccgccgag      1140
     gtcaatggct ataccgccac caaacaccag cgcgaggtcg gcaccggcta tttcgacgcc      1200
     gtgtcgctcg ccatcaccgg cggccggtcg tcgaccacgg cgatgcacgg ttcgaccgag      1260
     catgcgcagt tcaaaccggc tgcggaataa                                       1290
//

If you have problems or comments...

PBIL Back to PBIL home page