(data stored in ACNUC7421 zone)

EMBL: CP001622.PE405

CP001622.PE405       Location/Qualifiers
FT   CDS_pept        418751..420160
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0406"
FT                   /product="transcriptional regulator, XRE family"
FT                   /note="PFAM: protein of unknown function DUF955;
FT                   helix-turn-helix domain protein; SMART: helix-turn-helix
FT                   domain protein; KEGG: rec:RHECIAT_CH0000796 probable
FT                   transcriptional regulator protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0406"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54717"
FT                   /db_xref="GOA:C6B1J8"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010359"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR018653"
FT                   /db_xref="InterPro:IPR026281"
FT                   /db_xref="UniProtKB/TrEMBL:C6B1J8"
FT                   /inference="protein motif:PFAM:PF06114"
FT                   /protein_id="ACS54717.1"
FT                   /translation="MAERKIFAGPKVRRIRNALALTQTAMAEALEISPSYLNLIERNQR
FT                   PLTVQLLLKLASVYRVDLEELRGQTGGSLGQLKEVFADPLLSGELPGDQELVEVAEAAP
FT                   NAASGMIKLYRAYREQAARLSDLTVLMAAEGHAPVAAGRLPLDEVRETLERRSGYFARI
FT                   ETAAEAFAATLPGGLDLAAGLKDWLRSERGIAVRVLPVHVMPDLRRRFDRHSMRLFISE
FT                   RLSQADRAHEIAVEAATLALLPAIDAELDDLSLSSAEARRIARFELARIAALALAMPYE
FT                   AFLSAAKATRYDIDILRARFGVSFGQAAARLAMLQRPGAAAIPFFLIEIDAAGHRLRRA
FT                   GAQGFPQARFGGGCPKLNLHAAFLQPGQILAETVVMPDGASFLTVARTLEGPSVEFGER
FT                   VRRTAILIGCDAALGEGVVYGQAMALEPVAVGPACRLCERRGCLSRAEPPVTRPLGLDE
FT                   MVAGLSAFDFQ"
     atggcggaac ggaagatatt cgcaggcccg aaagtcaggc gcatccgcaa tgcgctggcg        60
     ctgacgcaga ccgccatggc cgaggcgttg gaaatatcgc cgtcctatct gaacctgatc       120
     gagcgcaacc agcggccgct gacggtgcag ctccttctca agcttgcaag cgtctacagg       180
     gtcgatctgg aagagttgcg cggacagacc ggcggcagtc tcggccagct caaggaggtc       240
     tttgccgatc cgctgctatc gggcgagctg ccgggtgatc aggaattggt ggaggtggcc       300
     gaggccgcac ccaatgccgc cagcggcatg atcaagctct accgcgccta tcgcgagcag       360
     gcggcgaggc tgtccgatct gacggtgctg atggccgccg aagggcatgc accggtcgcc       420
     gccggccggt tgccgctgga cgaggtgcgc gagacgctgg agcgcaggtc cggctatttc       480
     gcgcggatcg agacggcggc ggaagctttt gccgcaacgc tccccggcgg cctcgatctt       540
     gccgccgggc tgaaggattg gctgcgctcc gagcgcggca tcgcggtgcg tgtcttgccc       600
     gtccacgtca tgccggatct gcgccgtcgt ttcgatcgcc attcgatgcg gcttttcatc       660
     tcggagcgcc tttcgcaggc cgaccgtgcg cacgagattg cggtcgaggc cgcgactctg       720
     gccctgctgc cggcaatcga tgccgagctc gacgatctct cgctctcctc cgccgaggcg       780
     cgccgcatcg cccgcttcga gcttgcccgc atcgccgcgc tggcgcttgc aatgccctac       840
     gaggcctttc tctcggcggc gaaggcgacg cgctacgata tcgatattct gcgtgcgcgc       900
     ttcggcgtct ccttcggcca ggctgctgca cgtcttgcga tgctgcagcg ccccggggcg       960
     gccgccattc ccttcttcct gatcgagatc gatgccgccg gccaccggct gcgcagggcg      1020
     ggcgcccagg gctttccgca ggcccgtttc ggcggcggct gtccgaagct caatctccat      1080
     gccgctttcc tgcagccggg ccagatcctc gccgaaacgg tcgtcatgcc tgatggcgca      1140
     tccttcctga cggtcgcccg caccctggag ggaccgagcg tcgaattcgg cgaaagggtc      1200
     aggcgcacgg cgatcctgat cggctgcgac gctgcccttg gcgagggcgt ggtctatggg      1260
     caggcgatgg cgctcgagcc ggtcgcggtc ggtccggcct gtcgcctttg cgagcggcgc      1320
     ggctgccttt cccgggccga gccgccggtg acgagaccgc ttgggctcga cgagatggtg      1380
     gcaggcctca gcgccttcga tttccagtga                                       1410
//

If you have problems or comments...

PBIL Back to PBIL home page