(data stored in ACNUC7421 zone)

EMBL: CP001622.PE406

CP001622.PE406       Location/Qualifiers
FT   CDS_pept        420287..421384
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0407"
FT                   /product="extracellular solute-binding protein family 1"
FT                   /note="PFAM: extracellular solute-binding protein family 1;
FT                   KEGG: sme:SMc00770 putrescine-binding periplasmic protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0407"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54718"
FT                   /db_xref="GOA:C6B1J9"
FT                   /db_xref="InterPro:IPR001188"
FT                   /db_xref="InterPro:IPR006059"
FT                   /db_xref="UniProtKB/TrEMBL:C6B1J9"
FT                   /inference="protein motif:PFAM:PF01547"
FT                   /protein_id="ACS54718.1"
FT                   /translation="MRSTILCVTAAAVTALLAAAPALAQERVVNVYNWSDYIDSSILED
FT                   FTKETGIKVVYDTFDSNETLETKLLAGGSGYDVVVPTVSFMKRQIAAGVYQKLDKSKLP
FT                   NLVNMWDVIMKGVASFDPGNEYSVDYMWGTTGIGYNVDKVKAALGTDEKPNWDALFDPA
FT                   KAAKLKDCGIYMLDSPTDVVPSVLAYLGLNPNSTDAADLKKAQAVLTAVRPFVRKFHSS
FT                   EYISALANGDICIALGYSGDMFQARDRAKEANVGVKVDYSVPSQGAQIFFDVFGIPKDA
FT                   PHVAEAHEFINYMMKPEVVAKASNVVFYANGNKASQQFLDKEVLDDTAIYPTPEVMAKL
FT                   FTVPPLDPKAQRLVTRLWTTVVTGQ"
     atgaggtcaa ccatcctatg cgtgacggcc gccgctgtta ccgcactcct tgctgccgcg        60
     ccggcccttg cgcaggagcg cgtggtcaac gtctacaact ggtcggatta tatcgacagt       120
     tccatcctcg aggatttcac caaggaaacc ggcatcaagg tcgtctacga cacttttgat       180
     tccaacgaga cgctggaaac caagctcttg gctggtggtt cggggtacga cgtggtcgtc       240
     cccacggtat ccttcatgaa gcgccagatc gccgccggcg tctaccagaa gctcgacaag       300
     tcgaagctgc cgaacctggt caacatgtgg gacgtcatca tgaagggcgt ggcgtccttc       360
     gaccccggta acgaatacag cgtcgactac atgtggggca cgacgggcat cggctacaat       420
     gtcgacaagg tcaaggctgc cctcggaacc gacgaaaagc ccaattggga cgcgctgttc       480
     gacccggcga aagcagcaaa gctcaaggat tgcggcatct acatgctgga ttcccccacc       540
     gacgtggtgc cctcggtgct cgcctatctc gggctcaatc cgaacagtac cgacgctgcc       600
     gacctcaaga aggcgcaggc ggtcctcacg gccgttcgtc ccttcgtccg caagttccat       660
     tcgtccgaat atatcagcgc gctggcgaac ggcgatatct gcatcgcgct cggttattcc       720
     ggcgatatgt tccaggcccg tgaccgtgct aaggaagcca atgtcggcgt gaaggtcgat       780
     tattcggtcc cgtcgcaggg cgcccagatc ttctttgacg tcttcggcat tccgaaggat       840
     gcgccgcatg tcgccgaagc ccatgaattc atcaactaca tgatgaagcc cgaagtcgtc       900
     gccaaggcat ccaacgtcgt cttctatgcc aacggcaaca aggcgtcgca gcagttcctc       960
     gacaaggaag tcctcgacga cacggcgatc tacccaacgc ccgaagtcat ggcgaaactc      1020
     ttcaccgttc cgccgctcga tccgaaggcg cagcggctcg tgacgcggct atggaccacc      1080
     gtggtcaccg gccaatga                                                    1098
//

If you have problems or comments...

PBIL Back to PBIL home page