(data stored in ACNUC7421 zone)

EMBL: CP001622.PE407

CP001622.PE407       Location/Qualifiers
FT   CDS_pept        421498..422640
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0408"
FT                   /product="spermidine/putrescine ABC transporter ATPase
FT                   subunit"
FT                   /note="KEGG: rec:RHECIAT_CH0000798 spermidine/putrescine
FT                   ABC transporter, ATP-binding protein; TIGRFAM:
FT                   spermidine/putrescine ABC transporter ATPase subunit; PFAM:
FT                   ABC transporter related; Transport-associated OB domain
FT                   protein; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0408"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54719"
FT                   /db_xref="GOA:C6B1K0"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR005893"
FT                   /db_xref="InterPro:IPR008995"
FT                   /db_xref="InterPro:IPR013611"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C6B1K0"
FT                   /inference="protein motif:TFAM:TIGR01187"
FT                   /protein_id="ACS54719.1"
FT                   /translation="MKSLGNIRRSFAPWTDPSAKPFISIKNVTKRFGDFTAVDNLSLDI
FT                   YHREFFALLGASGCGKSTLLRMLAGFEQPTSGEIVLDGTDMAGTPPYRRPVNMMFQSYA
FT                   LFPHMTVEKNIAFGLRQDGMAKDEMTDRVLQMLKLVKLEQFASRKPNQLSGGQRQRVAL
FT                   ARSLAKRPKVLLLDEPLGALDKKLREETQFELMDLQQNLGLTFVVVTHDQEEAMTMADR
FT                   IAVMSHGKVVQVATPAEIYEAPNCRFVADFIGDVNIFDGKVASSGNGTVEISVDSGFSV
FT                   RVAAAETPSAGSAVGFAIRPEKMRVGRTPPANASVNAARGELWDIAYLGDMTVFHVKLQ
FT                   SGNVVKASSLNAQRSVDDPFTYDQEVWVSFDENAGVLLKD"
     atgaagtctt taggcaatat tcgccgctct ttcgcacctt ggaccgatcc gtccgccaag        60
     cccttcatat cgatcaagaa tgtcaccaag cgttttggcg atttcaccgc cgtcgacaac       120
     ctgtcgctcg acatctatca ccgtgagttc ttcgcgctgc tcggcgcttc gggctgcggc       180
     aagtcgacgc ttctgcgcat gctcgccggc ttcgagcagc cgacctcggg cgaaatcgtg       240
     ctcgacggca ccgacatggc cggcacgccg ccctataggc gccccgtcaa catgatgttc       300
     cagtcctatg cgcttttccc gcacatgacg gtcgagaaga acattgcctt cggcctgaga       360
     caggacggca tggcgaagga cgagatgacc gaccgcgtct tgcagatgtt gaagctcgtc       420
     aagctggagc aatttgcatc ccgcaagccg aaccagcttt ccggcggcca gcgccagcgc       480
     gtcgcgctgg cccgctcgct cgccaagcgc cccaaggtgc tgctgctcga cgaaccgctc       540
     ggcgcgctcg acaagaagct gcgcgaggaa acccagttcg agctgatgga cctgcagcag       600
     aatctcggcc tcaccttcgt cgtcgtcacc cacgatcagg aagaggcgat gaccatggcc       660
     gaccgtatcg ccgtcatgag ccacggcaag gtcgtgcagg tggcgacgcc ggccgagatc       720
     tacgaggcgc cgaattgccg tttcgtcgcg gatttcatcg gcgacgtgaa catcttcgac       780
     ggcaaggtcg cctcatcggg caacggcacc gtcgagatat cagtcgacag cggcttcagc       840
     gtgcgtgtcg ccgccgccga gactccctcg gcaggcagcg ccgtcggctt tgccatccgg       900
     ccggaaaaga tgcgggtcgg gcgcacgcct cccgccaacg cgtcggttaa cgctgcgagg       960
     ggcgaactct gggacatcgc ctatctcggc gacatgaccg tcttccatgt gaaattgcag      1020
     agcggcaacg tcgtcaaggc atcctccctc aacgcgcagc gctccgtcga cgaccccttc      1080
     acctacgatc aggaagtctg ggtctccttc gacgagaatg ccggcgtcct gctgaaggat      1140
     tga                                                                    1143
//

If you have problems or comments...

PBIL Back to PBIL home page