(data stored in ACNUC7421 zone)

EMBL: CP001622.PE408

CP001622.PE408       Location/Qualifiers
FT   CDS_pept        422645..423556
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0409"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: ret:RHE_CH00716
FT                   spermidine/putrescine ABC transporter, permease component I
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0409"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54720"
FT                   /db_xref="GOA:C6B1K1"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:C6B1K1"
FT                   /inference="protein motif:PFAM:PF00528"
FT                   /protein_id="ACS54720.1"
FT                   /translation="MGKFTSGLYNRLVIVIPYAWLLLFFLAPFFIVFRISLSTTAIAMP
FT                   PYEPVFSFADGWAGLLSKIGEFSFDNYTYLTDDPLYFNAYVSSVVIAGISTFLTLLIAY
FT                   PIAYGMAQAPRGLRPTLVMLVILPFWTSFLIRVYAWIAILKPEGLFNQLLLSLHLIDTP
FT                   LIILNTNTAVYIGIVYSYLPFMVLPLYSALEKMDGTLIEAAQDLGCPPITAFWRITFPL
FT                   SIPGVVAGCMLVFIPAVGEFVIPDLLGGSQTLMIGKTLWNEFNSNRDWPVSSAVATILL
FT                   LILVIPIVFFQNVQAKAEERGK"
     atgggcaagt tcacttccgg cctctacaat cgcctcgtca tcgtcatccc ttacgcctgg        60
     ctactgcttt tcttcctggc gcctttcttc atcgtcttcc gcatttcgct gtcgacgacg       120
     gcgatcgcca tgccgcccta tgagcctgtc ttctccttcg ccgacggctg ggccggcctc       180
     ttaagcaaga tcggcgaatt ctctttcgac aattacacct acctcaccga cgacccgctc       240
     tatttcaacg cctatgtgtc gagcgtggtg atcgccggga tctccacctt cctgacgctg       300
     ctgatcgcct atccgatcgc ctacggcatg gcgcaggcgc cacgtggcct gcggccgacg       360
     ctggtgatgc tcgtcatcct gcccttctgg acgagcttcc tgatccgcgt ctacgcctgg       420
     atcgccatcc tcaagccgga gggcctattc aaccagctgc tgctgtcgct gcacctgatc       480
     gatacaccgc tgatcatcct gaacaccaat accgccgtct atatcggcat cgtctattcc       540
     tatctgccct tcatggtgct gccgctttat tcggcgctcg agaagatgga cggcacgttg       600
     atcgaggctg cgcaggatct cggctgcccg ccgatcacag ccttctggcg catcaccttc       660
     ccgctgtcta tccccggcgt ggtggccggc tgcatgctgg tcttcatccc ggccgtcggt       720
     gaattcgtca ttcccgatct gctcggcggg tcgcagacgc tgatgatcgg caagacactg       780
     tggaacgagt tcaattccaa tcgcgactgg ccggtctcct cggcggtggc gaccatcctg       840
     ttgctgatcc tggtcatccc gatcgtcttc ttccagaatg tccaggccaa ggccgaagag       900
     cgggggaaat aa                                                           912
//

If you have problems or comments...

PBIL Back to PBIL home page