(data stored in ACNUC7421 zone)

EMBL: CP001622.PE409

CP001622.PE409       Location/Qualifiers
FT   CDS_pept        423560..424378
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0410"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: rec:RHECIAT_CH0000800
FT                   spermidine/putrescine ABC transporter, permease component
FT                   II protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0410"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54721"
FT                   /db_xref="GOA:C6B1K2"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:C6B1K2"
FT                   /inference="protein motif:PFAM:PF00528"
FT                   /protein_id="ACS54721.1"
FT                   /translation="MLKWTRFNIVSVTLGFAFLYLPIVLLVIFSFNESKLVTVWGGFST
FT                   KWYVSLMSNQALLDAAWVTLRVGLLSATFATILGTMAALTLVRYTRFRGRMLFSGMVYA
FT                   PLVMPEVITGLSLLLLFVAIGLDRGFWTITLAHTTLTMCFVAVVVQSRLLSFDHSIEEA
FT                   AQDLGAPPVRTFFEITLPIIAPAVASGWILAFTLSLDDLVIASFTSGPGATTLPMRIYS
FT                   QVRLGVTPEINAVCTILIGIVALGVICASIITKRRETQRQRDERAAAAGA"
     atgctgaaat ggacccgttt caacatcgtc tccgtcacgc tcggcttcgc tttcctctat        60
     ctgccgatcg tgcttctcgt cattttctcc ttcaacgaat ccaaactcgt gaccgtctgg       120
     ggcggcttct cgacgaaatg gtatgtctcg ttgatgagca atcaggcctt gctcgacgct       180
     gcgtgggtga cgctgcgcgt cggactgctg tcggcaacgt ttgcaaccat cctcggcacg       240
     atggcggcgc tgacattggt gcgctacacg cgctttcgcg gacgcatgct gttttcgggc       300
     atggtctatg cgcccctcgt catgccggag gtcatcaccg gcctgtcatt gctgctgctc       360
     ttcgtcgcga tcggtctcga ccgcggcttc tggacgatca cgctcgcgca tacgacgttg       420
     accatgtgct tcgtcgccgt cgtcgtccag tcgcgcctgc tgagtttcga tcattcgatc       480
     gaggaagcgg ctcaggatct cggcgcgccg ccggtgcgga ctttcttcga gatcaccctg       540
     ccgatcatcg cgcccgccgt cgcctccggc tggatcctgg ccttcaccct gtcgctcgac       600
     gatctggtga ttgcaagctt cacgtcgggg cctggcgcca ccacgctgcc gatgaggatc       660
     tacagccagg tccgcctcgg cgtaacgccc gagatcaatg cggtgtgcac gatcctgatc       720
     ggcatcgtcg ccctcggcgt catctgcgcc tcgatcatca ccaagcgccg cgaaacgcag       780
     cgacagaggg acgagcgcgc cgctgcggcc ggtgcgtga                              819
//

If you have problems or comments...

PBIL Back to PBIL home page