(data stored in ACNUC7421 zone)

EMBL: CP001622.PE41

CP001622.PE41        Location/Qualifiers
FT   CDS_pept        37209..38207
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0042"
FT                   /product="NAD-dependent epimerase/dehydratase"
FT                   /note="PFAM: NAD-dependent epimerase/dehydratase; 3-beta
FT                   hydroxysteroid dehydrogenase/isomerase; Male sterility
FT                   domain; short-chain dehydrogenase/reductase SDR; KEGG:
FT                   hne:HNE_3360 NAD-dependent epimerase/dehydratase family
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0042"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54353"
FT                   /db_xref="GOA:C6AYC9"
FT                   /db_xref="InterPro:IPR001509"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C6AYC9"
FT                   /inference="protein motif:PFAM:PF01370"
FT                   /protein_id="ACS54353.1"
FT                   /translation="MSITSDNSNGATVLVTGIGGFLAGHIALQLLKQGYRVRGSLRSIG
FT                   TSAATVGQLGAHTDGQLQNLGLVQADLDSDSGWAAAVEGCDYVIHTASPFPPGYPENEN
FT                   ALIQTARDGALRVLREAHRARVKRVVLTSSIAATNHGDGRAPFTEENWTDPESPRATPY
FT                   YKSKTLDLAVINPSVILGPLLGPNFGTSVGLIHHLMTGRFNGIPRFGFSVVDVRDTADA
FT                   HIRAMTDPAAGGQRFIIGGRFFWLKDLVAILAHSFPDHASRLPSGEVSDEIVRVMAQSD
FT                   PDARTIVHELNRDLSVSAAKAHRVLGWRSRPEEQCIRASAQSLIDLGLVPA"
     atgagtatca cgtcagataa ttctaatggc gccaccgtac tggtgaccgg cattggcgga        60
     tttctcgcag gccacattgc cttgcagttg ctcaagcagg ggtatcgggt cagaggaagc       120
     ctgcgcagca tcggtacaag cgctgcgacg gtcggtcagc ttggagcgca caccgacggg       180
     caactgcaaa atctcggttt ggtgcaggcc gatcttgaca gcgatagcgg ttgggctgcg       240
     gctgtcgaag gatgcgacta tgtcattcac accgcatcgc cgttccctcc gggatatccc       300
     gaaaatgaga atgcactgat ccagacagcc cgcgatggtg cgttgcgcgt gcttcgcgag       360
     gcgcatcggg cacgggtcaa acgtgttgtt ctgacatcct ccatagctgc caccaaccat       420
     ggcgacgggc gggcgccctt taccgaagag aattggaccg acccggaaag cccgcgggcg       480
     acgccctatt acaaatctaa gacgctcgat ctggccgtga tcaatccaag cgtcatcctc       540
     gggccgttgc tcgggccgaa tttcgggacg tctgttggat tgatccacca tttgatgacg       600
     ggacgattca acggtatccc gcgctttggc ttctccgtcg tggatgtgcg tgataccgcc       660
     gatgcccaca ttcgagcgat gaccgatcct gctgccggcg gccaacggtt catcatcggt       720
     ggacggtttt tctggctcaa ggaccttgtg gccattcttg cccattcctt tcccgaccat       780
     gcctcccgcc tgccgtccgg cgaagtctct gacgagatcg tcagggtcat ggcgcaatcc       840
     gaccccgatg cacgaaccat tgttcatgag ctcaatcgcg acctcagtgt cagtgcggca       900
     aaagcccacc gcgtcctcgg gtggcgctca cgtccagaag agcaatgcat ccgcgccagc       960
     gcccaaagcc tcatcgactt gggattggtg ccggcctag                              999
//

If you have problems or comments...

PBIL Back to PBIL home page