(data stored in ACNUC7421 zone)

EMBL: CP001622.PE410

CP001622.PE410       Location/Qualifiers
FT   CDS_pept        complement(424468..426360)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0411"
FT                   /product="AsmA family protein"
FT                   /note="PFAM: AsmA family protein; KEGG: ret:RHE_CH00718
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0411"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54722"
FT                   /db_xref="InterPro:IPR007844"
FT                   /db_xref="InterPro:IPR032712"
FT                   /db_xref="UniProtKB/TrEMBL:C6B1K3"
FT                   /inference="protein motif:PFAM:PF05170"
FT                   /protein_id="ACS54722.1"
FT                   /translation="MSTSRHRRWRRKIGPVSRWLPAFARLSTVFLLIALALFVALRVAA
FT                   PYLISTGFVRSGIEDALSKWTGYHAEIKGSPVLEFWPTPRITLNQITIRQPRESGDKLL
FT                   GSIESLSADFSLIDALRGRTSFHEFHLVRPNLALTRDEKGLIDWSYAGLLARAISGVRY
FT                   ENGAEVLDPDLDAEIGAVTVEDGTLVVTDIKSAKTYHFDSVTADIAWPRLSGAISSVVI
FT                   ARINGQDLKVDFASRQPLLAFAGRNAETRTSLTSNLLTAHFQGIASIANLSALSGNVTA
FT                   TIPDVPALLTWSGKSIPGIATLKSASLESDIMSSGNGLRFNNLSLSLNEASATGVMDLF
FT                   TQPGKRPKIGGTLAFDQMNLKPFLDAFALRLAAGEAEEISAGISGPLRLLDIDVRLSAR
FT                   RAQMGLFELSDVGASVIVAGGEAKFDIGDSQFEGGEMTAHLEATQRDFDGGGKLRLSIR
FT                   DADFAALAERLQLKGPLPLATGSIDLDLQSPKAIWTTGLADVTGKLHFWTGEGTIPGID
FT                   ATALRTQAAEKPFFPLSAAAGGAFAFSQLNLQADFANGSAEIHDAHIAGPTQTLTLSGI
FT                   ITYHSNGLALSGSLDATDPAKAAELPLLPFFIGGSWPNPVISPVPLFGNTPHAQ"
     atgagcacgt caagacatcg caggtggcgc aggaagatcg gacccgtttc gcgctggctt        60
     ccggccttcg cccgcctgtc gacggtattc ctgctgatcg cgctggcgct tttcgtggcg       120
     ctcagggttg ccgcacccta tctcatctcg accggcttcg tgcgctccgg catcgaggac       180
     gcgctgtcga aatggacggg ataccatgcc gagatcaagg gtagtccggt tctcgaattc       240
     tggccgacac cgcgcattac gctgaaccag atcaccatcc gccaaccgcg cgaaagtggc       300
     gataagctgc tcggcagcat tgaaagcctg tcggcggatt tcagcctcat cgatgcgttg       360
     cgaggccgga cgagcttcca cgaattccac ttggtgcgcc ccaacctggc gctgacgcgc       420
     gacgaaaaag ggctgatcga ctggagttat gccggcctgc tcgcacgcgc gatcagcggc       480
     gtacgctacg aaaacggagc tgaggtgctc gatcccgatc tcgatgccga gatcggcgcg       540
     gtgaccgtcg aggacggcac gcttgtggtc accgacatca agtccgccaa gacctatcat       600
     ttcgacagcg tcaccgcaga tatcgcctgg ccgagactat ccggcgcaat ctcgtcggtc       660
     gtcatcgccc gcatcaacgg ccaggacctg aaagtcgatt tcgcctcgcg ccagccgctg       720
     ctcgcctttg ccggcaggaa tgccgagaca cggacgtcgc tcacatcaaa cctgttgacg       780
     gcgcacttcc aaggcattgc cagcatcgcc aacctttcgg ccctttccgg caatgtcaca       840
     gccaccattc ccgatgtgcc cgcacttctg acatggtcgg gcaaatcgat ccccggcatc       900
     gcaacgttga agagcgcctc gctggaatcc gacatcatgt cgtcgggtaa tgggctgcgt       960
     ttcaacaatc tcagcctctc gttgaacgaa gcgagcgcca ccggggtaat ggaccttttc      1020
     acccaacccg gcaaacgacc gaaaatcggc ggcacgctcg ccttcgacca gatgaacctc      1080
     aagcccttcc tcgacgcctt cgcgctccgc ctcgcggccg gcgaggcgga ggaaatttcc      1140
     gccggcatca gcggaccatt gcggctgctc gatatcgacg tcaggctttc ggcgcggcgc      1200
     gcgcagatgg gtctcttcga gctttccgac gttggcgcca gcgtgatcgt tgccggcggc      1260
     gaagcgaaat tcgatattgg cgacagccag ttcgaaggcg gtgaaatgac cgcgcatctg      1320
     gaagcgacgc agcgcgactt cgacggcggc ggcaagctgc ggctgtcgat ccgcgatgcc      1380
     gacttcgcgg cccttgcaga acgcctgcag ttgaaaggtc cgctgccgct tgcgacagga      1440
     tcgatcgatc tcgacctgca gtcgcccaag gcgatctgga cgaccggcct tgccgacgtc      1500
     accggcaagc tgcacttctg gaccggggaa ggcacgattc ccggcatcga tgccacggca      1560
     cttcggacgc aggcagccga aaagccgttc tttccgctga gcgcggcagc aggcggcgcc      1620
     ttcgccttca gccagttgaa cctacaggcc gatttcgcca acggctccgc cgagatccat      1680
     gacgcccata tcgccggacc cacacagaca ctgacgcttt ccggcatcat cacctatcat      1740
     tcgaacgggc tggcactttc cggatcactg gatgcaaccg atccggccaa ggcggcggag      1800
     ctgccgcttc tgccgttctt catcggcggc tcatggccga acccggtgat ctcgccggtt      1860
     ccgctattcg gcaatacacc ccacgcgcag tga                                   1893
//

If you have problems or comments...

PBIL Back to PBIL home page