(data stored in ACNUC7421 zone)

EMBL: CP001622.PE411

CP001622.PE411       Location/Qualifiers
FT   CDS_pept        426636..428588
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0412"
FT                   /product="acetoacetyl-CoA synthase"
FT                   /note="TIGRFAM: acetoacetyl-CoA synthase; PFAM:
FT                   AMP-dependent synthetase and ligase; KEGG:
FT                   rec:RHECIAT_CH0000803 acetyl-CoA synthetase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0412"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54723"
FT                   /db_xref="GOA:C6B1K4"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR005914"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="InterPro:IPR025110"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:C6B1K4"
FT                   /inference="protein motif:TFAM:TIGR01217"
FT                   /protein_id="ACS54723.1"
FT                   /translation="MQDNRPLWVPSEDAIAKSPIHAFMERCNADFGLSLSGFEDLHAWS
FT                   VAERENFWSAVWDFCGVQGERGAEVLANGDRMLEARFFPDATLNFAENLLSGRGDGDAI
FT                   IFRGEDKAEDRWSWDRLRALVSKLQQAFVARGIGKGDRVAAMMPNMPETVAAMLAAASI
FT                   GAIWSSCSPDFGEQGVLDRFGQIEPRLFIACDAYWYSGKLQDVGAKVATVAKTLAIPTV
FT                   IVHYAGNAEAVARKTPGALTLEAFVAPYEAREVEFTRLAFAHPLYILFSSGTTGVPKCI
FT                   VHSAGGTLLQHLKEQRLHCGLQAGEKLFYFTTCGWMMWNWLVSGLASGATLCLFDGSPF
FT                   APDGNVLFDYAEAEKFVIFGTSAKYIDAVRKGGLTPRVSHDLSSLRLMTSTGSPLSPEG
FT                   FTFVYEGIKKDVQLASISGGTDIVSCFVLGNPLQPVWRGEIQGAGLGLAVDVWNDDGKP
FT                   VRGEKGELVCTKAFPSMPVMFWNDPDGAKYRAAYFDRFDNVWCHGDFAEWTEHGGLVIH
FT                   GRSDATLNPGGVRIGTAEIYNQVEQMAEVAEALCIGQDWDDDVRVILFVRLAPDVKLTE
FT                   DLVKAIKSRIRTGASPRHVPAKIIAVADIPRTKSGKIVELAVREVVHGRPVKNQEALAN
FT                   PEALGLFAGLSELRD"
     atgcaggata acagaccact ttgggtgccc tcggaggatg ccattgcaaa aagcccgatc        60
     catgccttca tggagcgctg caatgccgac ttcgggctct ctctttcggg ctttgaggat       120
     ctgcatgcat ggtcggtggc cgagcgggag aacttctggt cggccgtctg ggatttttgc       180
     ggcgtgcagg gggagcgtgg cgcagaggtg cttgccaatg gcgaccgcat gctggaagcc       240
     cgcttctttc ccgatgcgac gctgaacttc gccgaaaacc tgctgtctgg ccgcggtgac       300
     ggcgatgcga tcatcttccg cggcgaggac aaggccgagg accgctggtc gtgggaccgg       360
     ctgcgcgcgc tggtctcgaa gctgcagcag gcctttgtag cacgcggcat cggcaagggc       420
     gaccgcgtcg ccgcgatgat gccaaacatg ccggagaccg tcgccgccat gctcgccgcc       480
     gcctcgatcg gcgccatctg gtcgtcgtgt tcgcctgatt tcggcgagca gggtgtgctc       540
     gaccgcttcg gccagattga gccaaggctg ttcatcgcct gcgatgccta ttggtattcc       600
     ggcaagcttc aggatgtcgg cgccaaggtc gccacggtcg caaagacttt ggctatcccc       660
     acggtcatcg tccattacgc cggcaatgcg gaggccgtgg cgcgaaagac gccgggcgct       720
     ttaacgcttg aggcctttgt cgcgccctat gaggcaaggg aggtggagtt cacgcggctt       780
     gccttcgcgc atccgcttta catcctcttt tcgtcaggca cgacaggcgt accgaaatgc       840
     atcgtgcatt cggccggcgg cacgctgctg cagcacctca aggagcagcg gctgcattgc       900
     ggcctgcagg cgggcgagaa gctgttctat ttcaccactt gcggctggat gatgtggaac       960
     tggctggtca gcggtcttgc cagcggggcg acgctctgcc tgttcgacgg ctcgcccttc      1020
     gcccccgatg gcaacgtgct gttcgactat gccgaggccg aaaaattcgt catcttcggc      1080
     acctcggcga aatatatcga tgcggtgcgc aaaggcgggc tgacgccgcg cgtcagccac      1140
     gatctctcca gcctgcggct gatgacctcc accggttcgc cgctgtcgcc ggaagggttc      1200
     accttcgtct acgaaggcat caagaaagat gtacagctcg cctcgatatc aggcggcacc      1260
     gatatcgtct cctgcttcgt actcggcaat ccgctgcagc cggtctggcg cggcgagatc      1320
     cagggggccg gcctcggcct tgcggtcgat gtctggaacg atgacggcaa gccggtgcgc      1380
     ggggagaagg gtgaactcgt ctgcaccaag gccttcccct cgatgccggt gatgttctgg      1440
     aacgaccccg atggcgccaa atatcgcgcc gcctatttcg accggttcga caatgtctgg      1500
     tgccacggcg atttcgccga atggacggag catggcggcc tggtcatcca cggccgttcg      1560
     gatgcgacgc tcaatcctgg cggtgttcgc atcggcacgg ccgagatcta caatcaggtg      1620
     gagcagatgg cggaggtggc cgaggcgctg tgcatcggcc aggactggga cgacgacgta      1680
     cgcgtcatcc ttttcgtccg acttgccccc gatgtgaagc tgaccgagga tctcgtcaag      1740
     gcgatcaaga gccgcatccg caccggcgcc tcgccgcggc atgtgccggc gaagatcatc      1800
     gcggttgccg atattccccg caccaagtcc ggcaagattg tcgagcttgc cgtgcgcgag      1860
     gtcgttcacg gccggccggt gaagaaccag gaagcgcttg ccaatccaga ggcgctgggg      1920
     ctctttgccg ggctaagcga actgagggat tga                                   1953
//

If you have problems or comments...

PBIL Back to PBIL home page