(data stored in ACNUC7421 zone)

EMBL: CP001622.PE412

CP001622.PE412       Location/Qualifiers
FT   CDS_pept        complement(428804..432634)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0413"
FT                   /product="PAS/PAC sensor signal transduction histidine
FT                   kinase"
FT                   /note="KEGG: rec:RHECIAT_CH0000804 probable two-component
FT                   sensor histidine kinase protein; TIGRFAM: PAS sensor
FT                   protein; PFAM: ATP-binding region ATPase domain protein;
FT                   PAS fold domain protein; histidine kinase A domain protein;
FT                   SMART: ATP-binding region ATPase domain protein; histidine
FT                   kinase A domain protein; PAS domain containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0413"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54724"
FT                   /db_xref="GOA:C6B1K5"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR013767"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:C6B1K5"
FT                   /inference="protein motif:TFAM:TIGR00229"
FT                   /protein_id="ACS54724.1"
FT                   /translation="MPAVQYPFIDIAVHARVRERFSRGEAMVLFSADLARLLWANGAGA
FT                   ELFGHSAVYDLLDQGVDRADITFRQLETAARQLTDIGDSRSLMIRVAKGFQRAQVQAAA
FT                   ELIRLSQGEQAILFSVPVSAKPLAAGASAAQMLQGLDDPDTHMAVIGANGEVIAASPGF
FT                   ASLGISEQTAKTLINLAGAHPDRLVKRPVATGRGNLPAAVGKLSDDPALNLLFAVETAV
FT                   GHLDPVDAPALAPVDAPALDPVDAPAQEESAPPMEVLQDEPVAATGFTEIIDAVSGIEE
FT                   VEETLEEITGENEQPAEIAVASADEAIDGMDPAEDAEPKSDDGVTDSSADEPAAVIEDD
FT                   VTSIAETAEPPVEASETPIEDAPEAVHEETAIATPVVPDVPPAPQLEAESGFVFRPNSR
FT                   ATRFVWKIDAEGRFNEVSHEFAAAVGPHASDIIGSAFGDVAALFNLDPDGKLSEALARR
FT                   DTWSGKTILWPVEGTSLVVPVDLAALPTYTRNRDFDGFRGFGVVRLSDAQEDPLALGLT
FT                   LGPDGIGHDAASLGPPAETIAEVAHEAETVLEEPLIDPSPTQEVEDQALTASEPQAEPA
FT                   PEEIATEQAAEIPAQESAAEKAEGSADAGDISAAEPVAELPQEPPALRISETPNRRFSD
FT                   KIVQLHNTGAGLTAAEQANFREIAKRLEAFGANKDEPAAPAPMEPNATETAAFNEASGP
FT                   EAFGAETPTADQADIPSLEEIAPQEAIFENAVEAEREDDGATEEPAVIVEDEATEGLEE
FT                   TASQIEVLTSFIPPRIKMTDGLSVGTVDQLPVAVLIHIGDALIHANPEFMRLTGYGSLD
FT                   ALREVGGIEGLLQRRELEEKAAGSGTMMLVKADDTLAPVTARLQSVRWEDANALMLALM
FT                   PVEGKEDGRGDANRFDGRSEDRPERMVEKVAKLQVEVEELRSILETATDGVVVIGTEGD
FT                   IRSMNRSASALFNYDEQETRGKPFVMLFAHESQKAVIDYLNGLSGHGVASVLNDGREVI
FT                   GREAAGGFVPLFMTMGQLTSSNGYCAVIRDITQWKRTEDELRNAKGAAETANAHKTDFL
FT                   ARVSHEIRTPLNAIIGFSDMMAGERFGPIGHPRYIEYANDIGRSGRHVLDIVNDLLDIS
FT                   KIEAGEMDLDFAAVGLNEAVSEAVALVQPQANGQRVIIRTALSQAVPEVVADLRSIKQI
FT                   ALNILSNAIRFTPSGGQIVVSTSYEANGSVVLRVRDTGIGMTRSELDQAMKPFRQVSST
FT                   QSRHRGDGTGLGLPLTKAMVDANRATFTINSAPNEGTLVEITFPSQRVLAG"
     atgcccgcag tccaatatcc gttcatcgat atcgccgtgc atgcacgggt acgggaacgc        60
     ttttcacgcg gcgaggccat ggtgctgttt tcggccgatc tcgcccgtct gctctgggcg       120
     aacggtgcgg gtgccgagct tttcggccat tcggcggtct atgatctgct cgatcagggg       180
     gtcgaccgcg ccgacatcac cttccgccag ctggaaaccg ccgcgcgcca gctgaccgat       240
     atcggcgaca gccgcagcct gatgatccgc gtcgccaagg gctttcagcg tgcgcaggtg       300
     caggcggctg ccgaactgat ccggctttct cagggcgaac aggccatcct gttttcagtg       360
     ccggtctcgg caaaaccact cgcggccggc gcatcggcgg cccagatgct gcaggggctc       420
     gatgatcccg acacgcatat ggcggtgatc ggcgccaatg gtgaggtcat cgccgcttcg       480
     ccgggctttg cctcgctcgg gatctccgag cagacggcaa agaccttgat caaccttgcc       540
     ggcgcgcatc ccgaccggct ggtgaagcga cctgtcgcca ccggcagagg caatctcccg       600
     gccgcggtcg gcaagctcag cgacgatccg gcgctcaatc tgctctttgc tgtcgagacc       660
     gcggtcggtc atcttgaccc ggtcgatgcg cccgcgctcg ccccggtcga tgcgcccgcg       720
     ctcgatccag tcgatgcgcc cgcacaggaa gaaagcgcgc cgccgatgga ggtgcttcag       780
     gacgaacccg tcgccgctac aggcttcacc gaaatcatcg acgcggtctc ggggatcgaa       840
     gaggtcgagg agacgctcga ggagatcacc ggcgaaaacg agcagccggc tgagatagct       900
     gtggcatccg cagacgaggc gattgacggg atggatcctg ccgaggacgc ggagccgaag       960
     agcgacgacg gcgtgaccga tagcagcgcg gatgagcccg ccgcggtcat tgaggacgat      1020
     gtgacttcca ttgcggagac ggcggaaccg cctgttgaag ccagcgaaac gcctatcgaa      1080
     gacgcgccgg aagcagtcca cgaagagacc gctatcgcaa cgcctgtggt ccccgacgtg      1140
     ccccctgccc ctcagcttga ggctgagtcg ggcttcgttt tcaggccaaa tagccgcgcc      1200
     acgcgcttcg tttggaagat cgacgccgaa ggccgattca acgaagtcag ccacgaattt      1260
     gccgcggccg tcggtccgca tgcgtccgac atcatcggct ctgccttcgg cgatgtcgcc      1320
     gccctcttca atctcgatcc tgacggcaag ctttccgagg cgctcgcccg ccgtgacaca      1380
     tggtcgggca agacgatcct ctggccggtc gaaggcacca gcctcgttgt tccggtcgat      1440
     ctggcggcgc tgccgaccta tacccgcaac cgcgacttcg atggcttccg cggcttcggc      1500
     gtcgtccggc tttccgacgc gcaggaagat ccgctggcgc ttggcctgac actcggccct      1560
     gatggtatcg gccatgatgc agcgagcctc ggcccgcccg ccgagaccat tgccgaggtg      1620
     gcgcacgaag cggagacagt gcttgaagag cccctgatcg atccctcccc gacgcaggag      1680
     gtcgaggatc aggcgcttac ggcaagcgaa ccacaggcgg agccagcgcc ggaagagatt      1740
     gccaccgagc aggcggccga gatacctgcc caagaaagtg ctgccgaaaa agcggaaggc      1800
     agcgccgatg ccggcgacat ttccgccgcc gagccggtag cggaacttcc gcaagagccg      1860
     ccggcgcttc ggatttcgga aacgcctaat cgccgtttct ccgacaagat cgttcagctc      1920
     cacaacaccg gtgccggact gacggccgcc gaacaggcca atttccgcga gatcgccaag      1980
     cgcctcgaag ccttcggcgc caacaaggac gagcccgccg ccccggcgcc gatggaaccc      2040
     aacgccacgg aaacggccgc cttcaacgag gcctccggac ccgaagcgtt cggggccgaa      2100
     acacccaccg ccgaccaggc ggacataccg tcgctcgagg agatcgcgcc gcaggaggcg      2160
     atcttcgaga atgccgttga ggcggagcgc gaagacgacg gcgccaccga agagccggct      2220
     gtcatagtcg aggacgaggc gacggaaggg ctggaggaga cggccagcca gatcgaggtt      2280
     ctcacaagct tcatcccgcc gcgcatcaag atgacggacg ggctttcggt gggcacggtc      2340
     gaccaactgc ctgttgccgt gctcatccat atcggcgatg cgctgatcca cgccaatccg      2400
     gaattcatgc ggctgacggg ctacggttcg ctcgacgcat tgcgcgaggt aggcggcatc      2460
     gaaggtctgc tgcagcgccg cgaactcgag gagaaggccg cgggctccgg caccatgatg      2520
     ctcgtcaagg ccgatgatac gctggcgccg gtgaccgcgc ggctgcaatc ggtgcgctgg      2580
     gaagacgcca acgccctgat gctggcgctg atgccggtgg aaggcaagga agatggccgc      2640
     ggcgacgcaa accgtttcga cggtcggtcc gaagaccgcc ccgagcggat ggtcgagaag      2700
     gtcgctaaac tccaggtcga agtggaggaa ttgcgctcga tcctggaaac ggcgaccgac      2760
     ggcgtcgtcg tcattggcac cgagggcgac atccgctcga tgaaccggtc ggccagcgcg      2820
     cttttcaatt acgacgaaca ggagacgcgc ggcaaaccct tcgtcatgct gtttgcccat      2880
     gagagccaga aggcagtcat cgactatctg aacggcctct ccggccatgg cgtggcaagc      2940
     gtgttgaacg acgggcgcga agtgatcggc cgcgaggccg ccggtggctt cgtgccgctg      3000
     ttcatgacga tgggccagct cacctcctcc aacggctatt gcgccgtcat ccgcgatatc      3060
     acccagtgga agcgcaccga ggacgagctg cgcaacgcca agggcgctgc cgaaaccgcc      3120
     aacgcccaca agaccgattt cctcgcccgc gtcagccatg agatccgcac gccgctcaac      3180
     gccatcatcg gcttttccga tatgatggcc ggcgagcgct tcgggccgat cggccatccg      3240
     cgttatatcg aatatgccaa cgacatcggc cgctccggcc ggcacgtcct cgatatcgtt      3300
     aacgacctgc tcgacatctc gaagatcgag gcgggcgaga tggatctcga ttttgccgcc      3360
     gtcggcctca acgaggcggt ttccgaagcc gtggctctgg tgcagccgca ggcgaacggc      3420
     cagcgcgtca tcatccgcac ggcgctgtcg caggcagtac ctgaggtcgt agcggatctg      3480
     cgctcgatca agcagatcgc gctgaacatc ctgtcgaacg ccatccgctt caccccgtca      3540
     ggcgggcaga tcgtcgtttc gacgtcctat gaggcgaatg gcagcgttgt cctcagggtc      3600
     cgcgataccg gcatcggcat gacgcgcagc gaactcgacc aggcgatgaa gccgttccgg      3660
     caggtctcct cgacccaatc gcgtcatcgc ggcgacggca ccgggctcgg cctgccgctg      3720
     accaaggcga tggtcgatgc caaccgggcg actttcacga tcaattcggc gccgaacgag      3780
     ggcacgctcg tcgagatcac cttcccgtcg caacgcgtgc tggccggttg a               3831
//

If you have problems or comments...

PBIL Back to PBIL home page