(data stored in ACNUC7421 zone)

EMBL: CP001622.PE413

CP001622.PE413       Location/Qualifiers
FT   CDS_pept        432848..433297
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0414"
FT                   /product="phasin"
FT                   /note="TIGRFAM: phasin; KEGG: ret:RHE_CH00721 hypothetical
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0414"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54725"
FT                   /db_xref="InterPro:IPR010234"
FT                   /db_xref="InterPro:IPR018968"
FT                   /db_xref="UniProtKB/TrEMBL:C6B1K6"
FT                   /inference="protein motif:TFAM:TIGR01985"
FT                   /protein_id="ACS54725.1"
FT                   /translation="MATIKTDDVFSIASFDPSKFTESFREFAEKGAQQSKDAYAKLKTA
FT                   GEEAGKTLEATVQTAQAGSVEIGLKAIDILRINSENSLSHFEALLGVKSPAEFFELQTS
FT                   FIRKQAELTVEQAKSIQETTKQVAEKLAKPSKDAAEKAMASFKVA"
     atggctacca taaagaccga cgacgttttt tcaatcgctt ctttcgaccc gtccaagttc        60
     acggaatctt tccgtgaatt cgccgaaaag ggcgctcagc agtcgaagga tgcctatgcc       120
     aagctgaaga ccgctggcga ggaagccggc aagacgctcg aagccaccgt ccagacggca       180
     caggccggca gcgtcgagat cggcctgaag gcgatcgaca tcctgcgcat caattccgag       240
     aactcgctgt cgcacttcga agcgctgctc ggtgtcaagt ccccggccga attcttcgag       300
     ctgcagacct cgttcatccg caagcaggcc gaactcaccg tcgagcaggc gaagtcgatc       360
     caggaaacca ccaagcaggt ggccgagaag ctcgcaaagc cctccaagga cgccgccgaa       420
     aaggccatgg cttccttcaa ggttgcctga                                        450
//

If you have problems or comments...

PBIL Back to PBIL home page