(data stored in ACNUC7421 zone)

EMBL: CP001622.PE414

CP001622.PE414       Location/Qualifiers
FT   CDS_pept        433597..434040
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0415"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ret:RHE_CH00727 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0415"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54726"
FT                   /db_xref="InterPro:IPR025232"
FT                   /db_xref="UniProtKB/TrEMBL:C6B1K7"
FT                   /inference="similar to AA sequence:KEGG:RHE_CH00727"
FT                   /protein_id="ACS54726.1"
FT                   /translation="MSKTLLYGATKIDETNSAYAPMESLAAFQWKNRVFILFADRDNSR
FT                   ASRQENQLLADRSALDDRHLVVLKISGAGVRPLFGAADGLDGEAIRRDLEAPEVGEFAA
FT                   FLLGKDGTVKLEISEPITDGELFAIIDSMPMRAAESLKPDKSS"
     atgtcgaaaa cccttctcta cggtgcgacg aagatcgacg agaccaacag cgcttacgcg        60
     ccgatggaaa gtcttgctgc gtttcagtgg aagaaccgcg tcttcatcct tttcgccgac       120
     agggataatt cccgcgcctc ccggcaggag aaccagctac tggctgatcg ctccgccctc       180
     gatgaccggc acctggtggt gctgaagatt tccggcgctg gcgttcggcc gctcttcggt       240
     gcggccgacg gcctcgacgg cgaagcgatc cgccgcgatc tcgaggcacc ggaggtcggc       300
     gaattcgccg ctttccttct cggcaaggac ggcaccgtca agctcgagat cagcgagccg       360
     attaccgatg gcgagctctt cgccatcatc gacagcatgc cgatgcgcgc tgccgaatcg       420
     ctgaagccgg acaagtcgtc ctga                                              444
//

If you have problems or comments...

PBIL Back to PBIL home page