(data stored in ACNUC7421 zone)

EMBL: CP001622.PE416

CP001622.PE416       Location/Qualifiers
FT   CDS_pept        complement(434261..435142)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0417"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="PFAM: LysR substrate-binding; regulatory protein
FT                   LysR; KEGG: ret:RHE_CH00729 LysR family transcriptional
FT                   regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0417"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54728"
FT                   /db_xref="GOA:C6B1K9"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:C6B1K9"
FT                   /inference="protein motif:PFAM:PF03466"
FT                   /protein_id="ACS54728.1"
FT                   /translation="MNWDDVRIFLAVARTGQILAASKRLGLNHATLSRRLTSLEEALKT
FT                   RLFIRRTNGCELTAEGEVFLASAERMETEMLAAQASLGHTDTAIAGTVRVGAPDGFGVS
FT                   FLAPRMGRLIERHPELKIQLVPVPRSFSLSQREADIAITLERPEQGRLVSSKLTDYTLG
FT                   LYASRAYLAAQGTPADIDALKAHRRIGYVEDLIFTASLNFSGAVMRSWDAGFEISTAIG
FT                   QTEAVRTGAGIGILHDYIARQYPELQRILPEVSIRRAYWTTYHETARDLLRVRSVADFL
FT                   QELVSAERHIFL"
     atgaactggg acgatgttcg tattttcctc gccgtcgccc gcaccgggca gatccttgcc        60
     gcttcgaagc ggctggggct caatcacgcc acgctctcgc gtcgactgac ttcgctcgaa       120
     gaggcgctga agacgcggct tttcatccgc cgcacgaatg gctgcgaact gacggccgaa       180
     ggcgaagtgt tcctggcatc cgcggagcgg atggaaacgg aaatgctcgc agcacaggcc       240
     agcctcggcc acaccgatac ggcaatcgcc gggaccgtgc gcgtcggcgc gcctgatggg       300
     ttcggcgttt cctttcttgc gccgcgcatg ggcagattga tcgagcgtca tccggagctg       360
     aagatccagc tcgtaccggt gccgcgctct ttctcgctgt cgcagcgcga ggccgatatc       420
     gccatcacgc tggagcggcc cgaacaaggc cggctcgtct cctccaagct caccgactac       480
     acgctcggtc tctatgcctc acgcgcatac ctcgccgccc agggcacacc cgccgatatc       540
     gacgcgctca aggcgcatcg ccgcatcggc tatgtcgaag acctgatctt caccgcgtcc       600
     ctgaattttt ccggcgcagt catgcggagc tgggatgcag gcttcgagat ttcgacggcg       660
     atcggacaga ccgaggcggt acgaacaggt gccggcatcg gcatcctgca cgattatatc       720
     gccaggcaat atccggaact ccagcgcatc ctgccggagg tttcgatccg gcgcgcctac       780
     tggacgacct atcacgaaac ggcgcgcgac ctgctacgcg tccggagcgt cgccgatttc       840
     ctccaggagc ttgtcagcgc cgaacggcac attttccttt aa                          882
//

If you have problems or comments...

PBIL Back to PBIL home page