(data stored in ACNUC7421 zone)

EMBL: CP001622.PE417

CP001622.PE417       Location/Qualifiers
FT   CDS_pept        complement(435139..435453)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0418"
FT                   /product="Antibiotic biosynthesis monooxygenase"
FT                   /note="PFAM: Antibiotic biosynthesis monooxygenase; KEGG:
FT                   rec:RHECIAT_CH0000812 putative antibiotic biosynthesis
FT                   monooxygenase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0418"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54729"
FT                   /db_xref="GOA:C6B1L0"
FT                   /db_xref="InterPro:IPR007138"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="UniProtKB/TrEMBL:C6B1L0"
FT                   /inference="protein motif:PFAM:PF03992"
FT                   /protein_id="ACS54729.1"
FT                   /translation="MNRKPVVRMAELEIEPDTLETYRALLTEEIEASIALEDGVLSLSA
FT                   VSIRNNPNRIRILEVYADQEAYEAHLRTPHFIKYKNQTAHMVTSLTFIEVDPIAMRAKP
FT                   "
     atgaaccgga aacccgtcgt cagaatggcg gagttggaga tcgagccgga cacgcttgaa        60
     acctatcgcg cattgctcac ggaagagatc gaagcatcca tcgcgctgga agacggcgtc       120
     ctttccctga gcgccgtttc catcaggaac aacccaaacc ggatccgtat ccttgaagtc       180
     tacgccgacc aggaagcata cgaggcccat ctgcgaacac cgcatttcat taaatacaag       240
     aaccagacgg cacacatggt cacgtcgctg acttttatcg aggtcgatcc gatcgcaatg       300
     cgtgccaagc catga                                                        315
//

If you have problems or comments...

PBIL Back to PBIL home page