(data stored in ACNUC7421 zone)

EMBL: CP001622.PE418

CP001622.PE418       Location/Qualifiers
FT   CDS_pept        435646..437142
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0419"
FT                   /product="methylmalonate-semialdehyde dehydrogenase"
FT                   /note="TIGRFAM: methylmalonate-semialdehyde dehydrogenase;
FT                   PFAM: Aldehyde Dehydrogenase; KEGG: rec:RHECIAT_CH0000813
FT                   methylmalonate-semialdehyde dehydrogenase (acylating)
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0419"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54730"
FT                   /db_xref="GOA:C6B1L1"
FT                   /db_xref="InterPro:IPR010061"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016160"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="UniProtKB/TrEMBL:C6B1L1"
FT                   /inference="protein motif:TFAM:TIGR01722"
FT                   /protein_id="ACS54730.1"
FT                   /translation="MREIGHFIGGKHVAGTSGRVSNVYNPATGEVQATVALASVEELRA
FT                   AVENAKAAQPKWAATNPQRRARVFFKFVELLNKHMDELAEILSKEHGKTIEDAKGDVIR
FT                   GLEVCEFVCGIPHLAKGEFTEGAGPAIDMYSIRQPVGIGAGITPFNFPGMIPMWMFAPA
FT                   IACGNAFILKPSERDPSLPIRLGELMIEAGLPAGILNVVNGDKGAVDAILTDPDIGAVS
FT                   FVGSTPIARYVYGTAAMNGKRAQCFGGAKNHMIIMPDADLDQAVNALMGAGYGSAGERC
FT                   MAISVAVPVGEETANRLVEKLTPKIESLRIGPYTDDKADMGPLVTKEAYTRVRGLIDRG
FT                   IEEGAKLVVDGRDFKLQGYEDGYFVGGCLFDHVTPEMDIYKTEIFGPVLSVVRANNYEE
FT                   ALSLPMKHEYGNGVAIYTRDGDAARDFASRINIGMIGINVPIPVPLAYHSFGGWKASSF
FT                   GDLNQHGTDSIKFWTKTKTVTARWPSGIKSGAEFVMPTMK"
     atgcgtgaga tcggtcattt catcggcggc aaacatgttg ccggcaccag cggccgcgtg        60
     agcaatgtct acaatccggc gacgggcgaa gtgcaggcga cggtcgcact cgcaagcgtc       120
     gaggaactgc gcgccgccgt cgaaaacgcc aaggctgcgc agccgaaatg ggctgccacc       180
     aatccgcagc gccgcgcccg cgtcttcttc aaattcgtcg aactcctgaa caagcacatg       240
     gacgagcttg ccgaaatcct ctccaaggaa cacggcaaga cgatcgagga tgccaagggc       300
     gacgtcatcc gcggcctcga agtctgcgaa ttcgtctgcg gcatcccgca tctcgccaag       360
     ggcgaattca ccgagggcgc aggcccggcg atcgacatgt attcgatccg ccagccggtc       420
     ggcatcggcg ccggcatcac gcctttcaac ttccccggca tgatcccgat gtggatgttt       480
     gcgccggcga tcgcctgcgg caacgccttc atcctgaagc cctccgagcg tgatccctcc       540
     ctgccgatcc gtctcggtga actgatgatc gaggccggcc tgcccgccgg catcctcaac       600
     gtcgtcaatg gcgacaaggg tgctgtcgac gcgatcctca ccgatcccga tatcggcgcc       660
     gtctccttcg tcggctcgac gccgatcgcc cgctacgtct acggcaccgc ggcgatgaac       720
     ggcaagcgcg cccagtgctt cggcggcgcc aagaaccaca tgatcatcat gccggatgcg       780
     gacctggatc aggccgtcaa cgcgctgatg ggcgcaggct acggttcggc cggcgagcgc       840
     tgcatggcga tctcggttgc cgttccggtc ggcgaggaga ctgccaaccg cctcgtcgag       900
     aagctgacgc cgaagatcga atccctgcgt atcggcccct ataccgacga caaggccgac       960
     atgggcccgc tcgtcaccaa ggaagcctat acccgtgttc gcggcctgat cgaccgcggc      1020
     atcgaggaag gcgccaagct cgtcgtcgac ggccgcgatt tcaaactcca gggctatgaa      1080
     gacggctatt tcgtcggcgg ctgcctgttc gatcacgtca cgccggagat ggatatctac      1140
     aagacagaga tcttcggacc tgtcctctcc gtcgttcgcg ccaacaacta tgaggaagcg      1200
     ctgtcgttgc cgatgaagca cgaatacggc aacggcgttg cgatctacac ccgcgacggc      1260
     gatgccgccc gcgattttgc ctcgcgcatc aatatcggca tgatcggcat caacgttccg      1320
     atcccggttc cgctcgccta ccactccttc ggcggctgga aggcctcgag cttcggcgac      1380
     ctcaaccagc acggcacgga ttcgatcaag ttctggacga agaccaagac cgtcactgct      1440
     cgttggccct ccggcatcaa aagcggcgcg gaattcgtca tgccgacgat gaagtga         1497
//

If you have problems or comments...

PBIL Back to PBIL home page