(data stored in ACNUC7421 zone)

EMBL: CP001622.PE419

CP001622.PE419       Location/Qualifiers
FT   CDS_pept        437487..437969
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0421"
FT                   /product="transcriptional regulator, BadM/Rrf2 family"
FT                   /note="TIGRFAM: transcriptional regulator, Rrf2 family;
FT                   PFAM: protein of unknown function UPF0074; KEGG:
FT                   rec:RHECIAT_CH0000814 rhizobial iron transcriptional
FT                   regulator protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0421"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54731"
FT                   /db_xref="GOA:C6B1L2"
FT                   /db_xref="InterPro:IPR000944"
FT                   /db_xref="InterPro:IPR030489"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:C6B1L2"
FT                   /inference="protein motif:TFAM:TIGR00738"
FT                   /protein_id="ACS54731.1"
FT                   /translation="MRLTKQTNYAVRMLMYCAANDGHLSRIPEIARAYGVSELFLFKIL
FT                   QPLNKAGLVETVRGRNGGVRLGKPAADISLFDVVRVTEDSFAMAECFEDDGEVDCPLVD
FT                   SCGLNSALRKALNAFFAVLSEYSIDDLVKARPQINFLLGITGEPAYRKPSIVAPAA"
     atgcggttga cgaagcagac gaactatgcg gttcgcatgt tgatgtattg tgctgccaat        60
     gacgggcatt tgagccggat tcccgaaatc gccagggcct atggcgtttc cgagctcttt       120
     cttttcaaga tccttcagcc gctgaacaag gcgggtctgg tcgaaaccgt tcgcggtcgc       180
     aatggcggcg tgcgcttggg caagccggcc gccgacatta gtcttttcga cgtcgttcgg       240
     gtgacggaag acagcttcgc catggccgaa tgcttcgagg atgacggtga ggtcgactgc       300
     ccgctggtcg atagctgtgg tttgaattcg gcgctgcgca aggcgctcaa tgccttcttc       360
     gcggtgctgt cggaatattc catcgatgac ctcgttaagg cgcgtccgca gatcaatttc       420
     cttctcggaa tcaccggcga gccagcctat cgcaaaccct cgatcgttgc ccccgccgcc       480
     tga                                                                     483
//

If you have problems or comments...

PBIL Back to PBIL home page