(data stored in ACNUC7421 zone)

EMBL: CP001622.PE42

CP001622.PE42        Location/Qualifiers
FT   CDS_pept        38256..38660
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0043"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: reh:H16_A1246 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0043"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54354"
FT                   /db_xref="InterPro:IPR027843"
FT                   /db_xref="InterPro:IPR032710"
FT                   /db_xref="UniProtKB/TrEMBL:C6AYD0"
FT                   /inference="similar to AA sequence:KEGG:H16_A1246"
FT                   /protein_id="ACS54354.1"
FT                   /translation="MTIPTVDAFSPANEANLLRETEHARLRALINADIVRAQQLHAPDF
FT                   QLITPIGATLSKEEYLGAIASGQINYLIWEPADIAVRLYDGVAVLRYRAQLEVVFGGHK
FT                   VALNDYWHTDTYERHDGRWMVVWSQATAIN"
     atgacaatcc cgaccgtcga cgcattctcg ccggccaatg aggccaacct tcttcgcgag        60
     acggagcacg cgaggctgcg tgccctgatc aacgccgata ttgttcgggc acaacagctt       120
     cacgctccgg acttccagtt gataacgccg atcggtgcca cgctttccaa ggaagaatat       180
     ctaggtgcga tcgcctccgg gcagatcaac tacttgatct gggagcccgc tgacattgcc       240
     gtgcggcttt atgacggagt cgctgttctt cggtatcgtg ctcagctgga ggttgtcttc       300
     ggcggccaca aagtcgccct caacgactac tggcacactg acacttatga gcggcatgac       360
     ggacgatgga tggtggtctg gtcccaagcc acagccatca actag                       405
//

If you have problems or comments...

PBIL Back to PBIL home page