(data stored in ACNUC7421 zone)

EMBL: CP001622.PE420

CP001622.PE420       Location/Qualifiers
FT   CDS_pept        438308..439903
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0422"
FT                   /product="extracellular solute-binding protein family 5"
FT                   /note="PFAM: extracellular solute-binding protein family 5;
FT                   KEGG: rec:RHECIAT_CH0000815 dipeptide ABC transporter,
FT                   substrate-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0422"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54732"
FT                   /db_xref="GOA:C6B1L3"
FT                   /db_xref="InterPro:IPR000914"
FT                   /db_xref="InterPro:IPR030678"
FT                   /db_xref="InterPro:IPR039424"
FT                   /db_xref="UniProtKB/TrEMBL:C6B1L3"
FT                   /inference="protein motif:PFAM:PF00496"
FT                   /protein_id="ACS54732.1"
FT                   /translation="MKKISVLLAATALISVMATSAWSKTLVYCSEGSPEGFDPSLYTAG
FT                   TTFDASSRTVYSRLVEFKHGGTEIEPGLADSWSVSADGTEYTFKLHPGVKYQTTDFFTP
FT                   TRDFNADDVVFSFERQLKSDNPWNKYVEGGSYEYAAGMGFPELIKSVEKVDDLTVKFTL
FT                   NHPEAPFLADLAMDFASIVSKEYADKLAADGKMAQLNQQPLGTGPYTFVAYQPDAVIRY
FT                   KANETYFKGKEKIDDLVFAITSDAAVRAQKLKAGECHLIPYPNAADVPELKKDENLTVL
FT                   EQAGLNVGFLAYNTQMAPFDKPEVRRALNMAINKQAIIDAVFQGAAAVAKNPIPPTMWS
FT                   YNDAVQDDKYDPDAAKKALADAGVKDLSMKIWAMPVSRPYMLNARRAAELMQADFAKIG
FT                   VKVEIVTHEWAEYLKLSSDVKRDGAVILGWTGDNGDPDNFMDTLLGCDAVGGNNRAQWC
FT                   NKEYDDLMTKAKLTADVGERTKAYEQAQLIFKKEAPWATIDHSLVFVPMSKKVSGFQMD
FT                   PLGIHRFDGVDVSE"
     atgaaaaaga tctctgtcct gctggcagcg acggccttga tttccgtcat ggcgacgtcg        60
     gcttggtcca agacccttgt ttattgctcc gagggctcgc cggagggctt cgacccgagc       120
     ctctatacgg caggcacgac cttcgacgcg tcgtcgcgca cggtctatag ccgcctcgtc       180
     gaattcaagc atggcggtac cgagatcgaa ccgggcctgg ccgacagctg gagcgtttcg       240
     gccgacggca cggaatacac cttcaagctt catcctggcg tcaagtacca gaccaccgac       300
     ttcttcacgc cgacgcgcga tttcaacgcc gacgacgtcg tgttctcctt cgagcgccag       360
     ctgaaatccg acaatccgtg gaacaagtat gtcgagggcg gctcttacga atacgccgcc       420
     ggcatgggct ttcccgagct gatcaagtct gtcgagaagg tcgatgacct caccgtcaag       480
     ttcacgctca accaccccga agcgccgttc ctcgccgacc tcgccatgga cttcgcctcg       540
     atcgtctcca aggaatatgc cgacaagctt gccgccgacg gcaagatggc gcagctcaac       600
     cagcagccgc tcggcaccgg cccgtacacc ttcgtcgcct accagccgga tgccgtcatc       660
     cgctacaagg cgaacgaaac ctatttcaag ggcaaggaaa agatcgacga tctggttttc       720
     gccattacct ctgacgccgc cgtgcgcgcc cagaagctga aggccggcga atgccacctg       780
     atcccctatc cgaatgcagc cgacgtaccc gaactgaaga aggatgaaaa tctgaccgtt       840
     ctggaacagg ccggcctcaa tgtcggcttc ctcgcttaca acacccagat ggccccgttc       900
     gacaagccgg aagttcgccg tgcgctgaac atggcgatca acaagcaggc gatcatcgac       960
     gccgtcttcc agggtgccgc ggccgttgcc aagaacccga tcccgccgac gatgtggtcc      1020
     tataacgacg ccgttcagga cgacaagtac gatccggacg ctgccaagaa ggctcttgcc      1080
     gatgctggcg tcaaggatct cagcatgaag atctgggcaa tgccggtgtc gcgtccctac      1140
     atgctgaacg cgcgccgcgc cgccgaactg atgcaggcgg atttcgccaa gatcggtgtc      1200
     aaggtcgaga tcgtcaccca tgaatgggcc gaatatctga agctctcctc cgacgtgaag      1260
     cgcgacggcg ccgtcatcct cggctggacc ggcgacaacg gcgacccgga caacttcatg      1320
     gatacgctgc ttggctgcga tgccgtcggc ggcaacaacc gtgctcagtg gtgcaacaag      1380
     gaatatgacg acctgatgac caaggccaag ctgacggccg atgtcggcga gcgcaccaag      1440
     gcctatgagc aggcgcagct gatcttcaag aaggaagctc cctgggcaac catcgaccat      1500
     tcgctcgtct tcgttccgat gagcaagaag gtctcgggct tccagatgga cccgctcggc      1560
     attcaccgtt tcgacggcgt cgacgtatcc gaataa                                1596
//

If you have problems or comments...

PBIL Back to PBIL home page