(data stored in ACNUC7421 zone)

EMBL: CP001622.PE421

CP001622.PE421       Location/Qualifiers
FT   CDS_pept        439990..440994
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0423"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: rec:RHECIAT_CH0000816
FT                   dipeptide ABC transporter, permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0423"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54733"
FT                   /db_xref="GOA:C6B1L4"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:C6B1L4"
FT                   /inference="protein motif:PFAM:PF00528"
FT                   /protein_id="ACS54733.1"
FT                   /translation="MLRFFIGRLAVLIPTFLGVSLIAFSFIRMLPGDPVMLLSGERVMA
FT                   PERHAQIMHDLGFDRPMYVQYFDYLGKILHGDLGTSIVTKRPVLGEFLTLFPATLELSL
FT                   CAIILAVCLGVPAGIFAAVKRGTWFDQSVMGIALIGYSMPIFWWGLLLIIFFSGYLGWT
FT                   PVSGRISLMYFFKPVTGFMLVDSLLSGQKGAFSSAVSYLILPTIVLATIPLAVIARQTR
FT                   SAMLEVLGEDYVRTARSKGLKPLRVVGVHALRNAMIPVITTIGLQIGVLLAGAILTETI
FT                   FSWPGIGKWMVDSVFKRDYAVVQGGLLLIAGVIMLVNLIVDVLYGFINPRIRH"
     atgttgcgtt tttttatcgg ccgccttgcg gtgctgatcc cgacattcct cggcgtttcc        60
     ctcattgcct tctcgttcat ccgcatgctt cccggcgatc ccgtcatgct cctgtcgggg       120
     gaacgcgtca tggcgccgga gcggcacgcc cagatcatgc atgatctcgg tttcgaccgg       180
     ccgatgtatg tgcagtattt cgattatctc ggaaaaatcc tgcatggcga tctcggcacc       240
     tcgatcgtca ccaagcggcc cgttctcggc gaattcctga cactgtttcc ggcaacgctc       300
     gagctttcgc tctgtgccat catcctcgcc gtctgtcttg gcgtgcccgc cggtatcttt       360
     gccgccgtca agcgaggcac gtggttcgac caaagcgtga tgggtattgc ccttatcgga       420
     tattccatgc cgatcttctg gtgggggctg ctgctgatca tcttcttctc cggctatctc       480
     ggctggacgc ccgtttccgg ccgcatctcg ctgatgtatt tcttcaagcc ggtcaccgga       540
     ttcatgctgg tcgacagcct gctgtcgggc cagaagggcg cgttttcctc ggccgtcagc       600
     tacctcattc tgccgacgat cgtgctggcg accatcccgc ttgccgtcat cgcccgccag       660
     acgcgttcgg cgatgctcga ggttctgggt gaggattatg tccgcacggc gcgctcgaag       720
     ggcctgaagc cgctgcgcgt cgtcggcgtg catgcgctgc gcaatgcaat gatccctgtc       780
     atcaccacca tcggtctgca gatcggcgtt cttcttgccg gcgccatcct caccgagacg       840
     atcttctcct ggccgggcat cggcaaatgg atggtcgatt cggtgttcaa gcgcgattac       900
     gccgtggtcc agggcggtct tctgctgatc gccggcgtca tcatgctggt caacctgatt       960
     gttgatgttc tctacggctt catcaatccg cgcattcgtc attag                      1005
//

If you have problems or comments...

PBIL Back to PBIL home page