(data stored in ACNUC7421 zone)

EMBL: CP001622.PE422

CP001622.PE422       Location/Qualifiers
FT   CDS_pept        441004..441894
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0424"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: rec:RHECIAT_CH0000817
FT                   dipeptide ABC transporter, permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0424"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54734"
FT                   /db_xref="GOA:C6B1L5"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR025966"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:C6B1L5"
FT                   /inference="protein motif:PFAM:PF00528"
FT                   /protein_id="ACS54734.1"
FT                   /translation="MSTVTVKTGQPSALAEFWHYFSRNKGAVIGLVVFTIILVVAVLAP
FT                   LFAPHEPNEQNRAVLLAVPFWMEGGSASFPLGTDAVGRDILSRLIYGARFSLFIGVVVV
FT                   TLSVISGVLIGLVAGFFRGKVDTAIMRLMDIILAFPSLLLALVLVAVLGPGLTNAMIAI
FT                   SLVNQPHFVRLTRASVISEREKEYVIASRVAGAGTFRLMFKTILPNCLGPLIVQATLAF
FT                   SAAILDAAALGFLGMGAQPPTPEWGTMLAESREFISRAWWVVTFPGLAILITVLAINLM
FT                   GDGLRDALDPKLKRS"
     atgagcacgg tcaccgtcaa aaccggccag ccatccgctc ttgcggagtt ctggcattat        60
     ttctcccgca acaagggcgc cgtcatcggc ctcgtggttt tcaccatcat cctggtcgtc       120
     gcagtcctcg cgccgctctt tgcgccacat gaaccgaacg agcagaaccg cgcggtactg       180
     ctcgcagtgc cgttctggat ggagggtggc agcgcctcct tcccgctcgg aacggatgcc       240
     gtcggccgcg atatcctttc gcgcctgatc tatggcgcgc ggttttcgct gttcatcggc       300
     gtcgtcgtcg tcacgctttc ggtcatttca ggcgtcctga tcggcctcgt cgccggattc       360
     ttccgcggca aggtcgatac ggcgatcatg cgcctgatgg atatcatcct ggccttcccg       420
     tcactgttgc tcgctctcgt tctggtggcc gtgcttgggc ctggtctgac caatgcgatg       480
     atcgcgattt cgctggtcaa ccagccgcat ttcgtgcggc tgacgcgcgc ctcggtcatt       540
     tctgagcgtg agaaggaata tgtcatcgcc tcgcgtgtcg ccggtgccgg caccttccgg       600
     ttgatgttca agacgatcct gccgaactgt ctgggcccac tgatcgttca ggcgacgctc       660
     gccttctcgg cggcgattct cgatgccgcc gccctcggct ttctcggcat gggcgcccag       720
     ccgccgacgc ccgaatgggg gacgatgctg gccgaatccc gtgagttcat ctcgcgcgcc       780
     tggtgggtgg tgacattccc gggtcttgcc atcctcatca ccgttcttgc catcaacctg       840
     atgggcgacg gcctgcgcga tgcgctcgat cccaaactga agaggtcgtg a                891
//

If you have problems or comments...

PBIL Back to PBIL home page