(data stored in ACNUC7421 zone)

EMBL: CP001622.PE423

CP001622.PE423       Location/Qualifiers
FT   CDS_pept        441894..442910
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0425"
FT                   /product="oligopeptide/dipeptide ABC transporter, ATPase
FT                   subunit"
FT                   /note="KEGG: ret:RHE_CH00739 dipeptide ABC transporter,
FT                   ATP-binding protein; TIGRFAM: oligopeptide/dipeptide ABC
FT                   transporter, ATPase subunit; PFAM: ABC transporter related;
FT                   Oligopeptide/dipeptide ABC transporter domain protein;
FT                   SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0425"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54735"
FT                   /db_xref="GOA:C6B1L6"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR013563"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C6B1L6"
FT                   /inference="protein motif:TFAM:TIGR01727"
FT                   /protein_id="ACS54735.1"
FT                   /translation="MPLLEIENLTVEFQTSSGLFRAVDGVSLACDKGEILSVVGESGSG
FT                   KSVAMLALMGLLPWTAKITADRMQFDGKDLRGISGRQRRRIVGKDMAMIFQEPMSSLNP
FT                   CFTVGFQLGETLRFHMGLNRKERRQRSIELLNLVGIPAPEDRLSNFPHQMSGGMSQRVM
FT                   IAMALACNPKLLIADEPTTALDVTIQAQILDLLVRLQKEQGMALVLITHDMGVVAETAE
FT                   RVQVQYAGQKVEEQPVRALFRDPHHPYTAALLAALPERAKVGQRLPSIAGVVPGQHGRP
FT                   TGCLFAPRCGFATVECDRGVVRQGPELGLALCNYPLKDGKPLGHPGIMAVETAGDLV"
     atgccgctcc tcgagattga aaatctgacg gtcgaattcc agacctcttc cggcctcttc        60
     cgcgccgtcg acggtgtgtc gcttgcctgc gacaagggcg agatcctgtc ggtcgtcggc       120
     gaatccggct cgggtaaatc cgttgccatg ctggccctga tggggcttct gccctggacg       180
     gcgaagatca ccgccgaccg catgcagttc gacggcaagg atctgcgcgg catctccggc       240
     cgccagcgcc gcaggattgt cggcaaggat atggcgatga tcttccagga gccgatgtcg       300
     agcctcaatc cgtgcttcac ggtcggtttc cagctcggcg agaccctgcg cttccatatg       360
     ggcctcaacc gcaaggagcg ccgccaacgc tcgatcgagc tcttgaacct cgtcggcatt       420
     ccggctccgg aagaccgcct gtcgaacttt ccgcatcaga tgtccggcgg catgagccag       480
     cgcgtcatga tcgccatggc gctcgcctgc aatccgaagc tcttgatcgc cgacgagccg       540
     acaacggcgc tcgacgtgac gatccaggca cagatcctcg atctgctcgt tcgcctgcag       600
     aaggagcagg gcatggcgct ggtgctgatc acccacgaca tgggtgtcgt tgccgaaacc       660
     gccgaacgcg tgcaggtgca atatgccggc cagaaggtcg aggagcagcc ggtgagggcg       720
     ctgttccgcg atccgcatca tccctatacc gcagccctgc tcgcagccct tcccgaacgc       780
     gcaaaagtcg gccagcgtct tccctcgatc gccggtgtcg ttcccggcca gcatggtcgc       840
     ccgacaggct gtctgtttgc gccgcgctgc ggcttcgcca cggtcgaatg cgatcgcggt       900
     gtcgtccgcc aggggccgga gctcggcctg gcgctctgca actatccctt gaaggatggt       960
     aagccgctcg gacatcccgg catcatggcc gttgaaactg caggagacct cgtatga         1017
//

If you have problems or comments...

PBIL Back to PBIL home page