(data stored in ACNUC7421 zone)

EMBL: CP001622.PE424

CP001622.PE424       Location/Qualifiers
FT   CDS_pept        442907..443860
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0426"
FT                   /product="oligopeptide/dipeptide ABC transporter, ATPase
FT                   subunit"
FT                   /note="KEGG: ret:RHE_CH00740 dipeptide transporter
FT                   ATP-binding subunit; TIGRFAM: oligopeptide/dipeptide ABC
FT                   transporter, ATPase subunit; PFAM: ABC transporter related;
FT                   Oligopeptide/dipeptide ABC transporter domain protein;
FT                   SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0426"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54736"
FT                   /db_xref="GOA:C6B1L7"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR013563"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C6B1L7"
FT                   /inference="protein motif:TFAM:TIGR01727"
FT                   /protein_id="ACS54736.1"
FT                   /translation="MTDAVLEGRDLARFYTVNRGLFKADATVKALNGVSFSLHSGKTLA
FT                   VVGESGCGKSTLARLVTMIENPTSGQLLIDGKPAHVGDRSLRSQVQIVFQNPYGSLNPR
FT                   QKVGSILEEPLKINTNLDGAARRRKAEEMMARVGLRPEHYGRYPHMFSGGQRQRIAIAR
FT                   ALMLRPKVLVLDEPVSALDLSIQAQVLNLLMDLQKEMGLAYLFISHGLSVVHHIADEVM
FT                   VMYLGRPVETGPAAEVFARPRHPYTAALLSATPIADPDRAKNRIRLQGELPSPLKPPTG
FT                   CHFNPRCWKAQDHCRQVSPELSGEGTHQYACHFPLD"
     atgacggacg ctgttctcga gggcagggat ctcgcccgct tctacaccgt caatcgcggt        60
     ctgttcaaag ccgatgccac cgtcaaggcg ctgaacggcg tcagcttcag cctgcattcc       120
     ggcaagacgc tcgccgtcgt cggcgaatcc ggctgcggca agtcgacgct cgcccgcctg       180
     gtcaccatga tcgagaaccc gacatcgggg cagttactga tcgacggcaa gcccgcccat       240
     gtcggcgatc gtagcctgcg cagccaggtg cagatcgttt tccagaatcc ctacggctcg       300
     ctcaatccgc gccagaaggt cggctcaatc ctcgaagagc cgctgaagat caacaccaat       360
     ctcgacggcg ccgcccgccg ccgcaaggcg gaggagatga tggctcgtgt cggcctgcgt       420
     ccggagcatt atggccgata tccccatatg ttctccggcg gtcagcgcca gcgtatcgcc       480
     attgcccgcg ccctgatgct gcggccaaag gtgctggtgc tcgacgaacc ggtctcggcg       540
     cttgacctgt cgatccaggc gcaggtgctg aacctgctga tggacctgca gaaggagatg       600
     gggctcgcct atctcttcat ctcgcacgga ctgtccgtcg tccatcatat cgccgacgag       660
     gtgatggtga tgtatctcgg ccgtcccgtg gaaaccggtc ccgccgccga ggtcttcgcc       720
     cggccacgcc atccctacac ggcagccttg ctgtcagcga cgccgatcgc cgatcccgac       780
     cgtgcgaaga accgcatccg cctgcagggt gaactgcctt cgccgctgaa gccgccgacg       840
     ggctgccact tcaatccgcg ctgctggaag gcgcaggacc attgccgtca ggtttctccc       900
     gaattaagtg gagaaggcac acatcaatat gcctgtcact tcccgctcga ttga             954
//

If you have problems or comments...

PBIL Back to PBIL home page