(data stored in ACNUC7421 zone)

EMBL: CP001622.PE425

CP001622.PE425       Location/Qualifiers
FT   CDS_pept        443982..444518
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0427"
FT                   /product="carbohydrate kinase, thermoresistant glucokinase
FT                   family"
FT                   /EC_number="2.7.1.12"
FT                   /note="KEGG: rec:RHECIAT_CH0000820 gluconokinase protein;
FT                   TIGRFAM: carbohydrate kinase, thermoresistant glucokinase
FT                   family; PFAM: shikimate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0427"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54737"
FT                   /db_xref="GOA:C6B1L8"
FT                   /db_xref="InterPro:IPR006001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031322"
FT                   /db_xref="UniProtKB/TrEMBL:C6B1L8"
FT                   /inference="protein motif:TFAM:TIGR01313"
FT                   /protein_id="ACS54737.1"
FT                   /translation="MPEQMNKPQAIIVMGVSGCGKSSVGEKLAEALHLAFVEGDALHPA
FT                   ANVEKMSKGIALTDEDRMPWLDRIGEDMKASLEKSKGIIVSCSALKRLYRDRLRAAAGG
FT                   NLFFVYLEGSRALLMKRMGERKGHFMPVSLLDSQLATLEVPTGEPGVVTVDIDDTIDGI
FT                   AATALKSLAALGVTG"
     atgccggagc agatgaacaa accccaggcg atcatcgtca tgggagtcag cggctgcggc        60
     aaatcctccg tcggtgagaa actcgccgaa gccctgcacc tggccttcgt cgaaggtgat       120
     gcgcttcatc cggccgccaa tgtcgagaag atgtcgaagg gcattgcgct gaccgatgaa       180
     gaccggatgc cgtggctcga ccgcatcggc gaagacatga aagcctcgct ggagaagagc       240
     aagggcatca tcgtttcctg ctcggcgctg aagcgcctct atcgcgacag gctgagggct       300
     gctgccggcg gcaatctctt cttcgtttat ctcgaaggtt ccagggcgct gctgatgaaa       360
     aggatgggtg agcgcaaggg gcacttcatg ccggtctcgc tgctcgacag ccagctggcg       420
     acgcttgagg tgcccacagg cgagcctggt gtcgtcaccg tggatatcga cgacacgatc       480
     gacggcatcg cggcaacggc gctcaagagc cttgcagcgc tcggcgtcac gggttga          537
//

If you have problems or comments...

PBIL Back to PBIL home page