(data stored in ACNUC7421 zone)

EMBL: CP001622.PE426

CP001622.PE426       Location/Qualifiers
FT   CDS_pept        complement(444508..445755)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0428"
FT                   /product="FAD dependent oxidoreductase"
FT                   /note="PFAM: FAD dependent oxidoreductase; KEGG:
FT                   rec:RHECIAT_CH0000821 putative D-amino acid dehydrogenase
FT                   protein; SNP /replace=C"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0428"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54738"
FT                   /db_xref="GOA:C6B1L9"
FT                   /db_xref="InterPro:IPR006076"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:C6B1L9"
FT                   /inference="protein motif:PFAM:PF01266"
FT                   /protein_id="ACS54738.1"
FT                   /translation="MTKNAIVLGAGIVGVSTAIHLQRRGRQVTLIDRKDPGNETSFGNA
FT                   GLIQREGVAPYGFPQQLGLLLRYAVNNRIDAHYHLRALPSQIAFLARYWWNSNARRHAI
FT                   ITRAYAPLIENSVVEHKDLIEASQAEGLIRKDGWIKIFRTEAKRDGALAEAALWQNEFG
FT                   VEYDSLTPADIARMEPYMTGDFAGGIRWRDPWSVLDPHALTSAYRRYFESLGGRFVTGD
FT                   AASLGPFGSGWKIMTAEGPLEAEDAVMALGPWAAVATRRLGYSFPLGVKRGYHMHYAAG
FT                   GNAVLNNWMLDAERGYLLAPMNRGIRLTTGAEFATLDAPKTPVQLDRAEAVARTIFPLG
FT                   DRLDPEPWMGARPCTPDMMPVIGKAPRHQGLWFAFGHAHHGLTLGPVTGRVLAELITGE
FT                   TPFIDISAYSPQRFNP"
     atgacgaaga acgcaatcgt gctcggcgcc ggcatcgtcg gggtttccac ggccatccat        60
     cttcagcggc gcggccggca ggtgacgctg atcgaccgca aggatccggg caacgaaacc       120
     tcgttcggca atgccggcct gatccagcgc gaaggtgtcg cgccttacgg ctttccccag       180
     cagctcgggc ttttactgcg ttatgctgtg aataaccgca tcgacgcgca ttatcatctg       240
     cgcgcactgc cgagccagat cgcctttctc gctcgctact ggtggaattc caatgcgcgt       300
     cgccacgcaa tcattacccg ggcctatgca ccgctgatcg aaaattcggt tgtcgaacac       360
     aaggatctga tcgaggcgtc gcaggccgaa gggctgatcc gcaaggacgg ctggataaag       420
     attttccgca ctgaagccaa gcgcgacggg gctcttgcag aggcagcact ttggcagaat       480
     gaattcggcg tggagtatga cagcctgact ccggccgata tcgcccgcat ggagccgtat       540
     atgaccggcg atttcgccgg cggcatccgc tggcgcgacc cctggtcggt gctcgacccg       600
     catgcgctga catcggccta tcgccgctat ttcgagagcc tcggcggccg cttcgtcacg       660
     ggtgacgccg cctcgctcgg tccgttcggc tccggctgga aaatcatgac ggcggaaggt       720
     ccgctcgaag ccgaggatgc ggtgatggcg ctcggccctt gggcggccgt tgctacgcgc       780
     cggctcggct actccttccc gctcggcgtc aagcgcggct atcacatgca ctatgccgcc       840
     ggaggcaatg ctgtgctcaa caactggatg ctcgatgccg aacgcggcta tctccttgcg       900
     ccgatgaacc gaggcatccg cctgacgaca ggggcggagt ttgcaacgct cgacgcgccc       960
     aagacgccgg tccagctcga ccgcgccgaa gcggtggcgc gcaccatctt cccgctcgga      1020
     gacaggctcg atcccgaacc ctggatgggc gcgcgcccct gcacgccgga tatgatgcct      1080
     gttatcggca aggcgccgcg ccatcagggc ctgtggtttg ccttcggcca tgcccatcat      1140
     gggctgacgc tcgggccggt aaccggccgc gtgcttgccg aactcatcac cggcgagacg      1200
     ccgttcatcg atatttcggc ctattcgccg cagcgtttca acccgtga                   1248
//

If you have problems or comments...

PBIL Back to PBIL home page