(data stored in ACNUC7421 zone)

EMBL: CP001622.PE427

CP001622.PE427       Location/Qualifiers
FT   CDS_pept        complement(445832..446335)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0429"
FT                   /product="Isoprenylcysteine carboxyl methyltransferase"
FT                   /note="PFAM: Isoprenylcysteine carboxyl methyltransferase;
FT                   KEGG: ret:RHE_CH00743 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0429"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54739"
FT                   /db_xref="GOA:C6B1M0"
FT                   /db_xref="InterPro:IPR007269"
FT                   /db_xref="UniProtKB/TrEMBL:C6B1M0"
FT                   /inference="protein motif:PFAM:PF04140"
FT                   /protein_id="ACS54739.1"
FT                   /translation="MMWPSIALLAFVTLQRLAELVLARRNTAALLSRGAREVAPEHYPT
FT                   MVALHAGWIIGLWLLAPGRPVAFFWFLVFMGLQALRLWVLATLKGRWTTRIIVLPGAPL
FT                   VRSGPYRFLRHPNYAIVVGEIAVLPLAFGLPLYAIVFSLLNALILHVRVKAENAALKSA
FT                   MILK"
     atgatgtggc cgtcgatcgc gcttctggca ttcgtgacgc tgcagcggct ggcggaactc        60
     gtgctcgccc ggcgcaacac ggcggcgctt ctttccaggg gcgccagaga ggtggcaccc       120
     gagcattatc ccaccatggt ggcgctgcat gcaggctgga tcatcggcct ttggctgctt       180
     gcaccgggca ggccagtcgc gttcttctgg tttctggtgt tcatggggct gcaggcgctg       240
     cggctctggg tgctggcgac gctgaaaggc cgctggacga cgcgcatcat cgtcctgccc       300
     ggcgcgccgc tggtcagatc cgggccctat cgcttcctcc gccatccgaa ctatgcgatc       360
     gtcgtcggcg agatcgccgt ccttcccctc gccttcggcc taccgcttta cgcgatcgtc       420
     ttttcccttc tcaacgcgct tatcctccat gtccgcgtga aggctgaaaa tgccgcactg       480
     aaaagcgcaa tgattttgaa atga                                              504
//

If you have problems or comments...

PBIL Back to PBIL home page