(data stored in ACNUC7421 zone)

EMBL: CP001622.PE428

CP001622.PE428       Location/Qualifiers
FT   CDS_pept        complement(446332..447384)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0430"
FT                   /product="chalcone and stilbene synthase domain protein"
FT                   /note="PFAM: chalcone and stilbene synthase domain protein;
FT                   FAE1/Type III polyketide synthase-like protein;
FT                   3-Oxoacyl-[acyl-carrier-protein (ACP)] synthase III domain
FT                   protein; KEGG: rec:RHECIAT_CH0000823 probable chalcone
FT                   synthase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0430"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54740"
FT                   /db_xref="GOA:C6B1M1"
FT                   /db_xref="InterPro:IPR001099"
FT                   /db_xref="InterPro:IPR011141"
FT                   /db_xref="InterPro:IPR012328"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="UniProtKB/TrEMBL:C6B1M1"
FT                   /inference="protein motif:PFAM:PF02797"
FT                   /protein_id="ACS54740.1"
FT                   /translation="MTDTVKLVSLAVATPEHVIFQKQAVEASARLFADRFEDFRHLARV
FT                   FDSAGIDKRHAARPLAWFDEPHGWQDRMQAFAEVAGGLFVEAASSALRQAGLETGDVDC
FT                   VVTVSSTGFTTPSLDAQLAGRMGFRPDIERVPVFGLGCAAGVSGFAIASRLARSRPGTV
FT                   VLFVSIELCTLAFRLDELTRPNIIATALFGDGAAACVLRSGEDGLAEVESTGEHLFPDT
FT                   LDIMGWKIDDGGFGIVLAQSLPPFAEKELGPAVTAILARNGLRVEDIDRFICHPGGMKV
FT                   LAAMESALSMVPGTLDHERAVLAEYGNMSSPTILFVLERAIRAGLPARAAMIAMGPGFS
FT                   ASCVTLRRVA"
     gtgaccgaca ccgtcaaact cgtcagcctc gccgttgcca cacccgaaca tgtcattttc        60
     caaaaacagg cggtcgaagc ctcggcccgg ttgtttgccg accgcttcga ggacttccgc       120
     catcttgccc gcgtcttcga tagcgccggt atcgacaagc gccatgcggc gcggccgctt       180
     gcctggttcg acgagccaca tggctggcaa gaccggatgc aggcctttgc agaggtcgca       240
     ggcgggcttt tcgtcgaggc tgccagctcg gcccttcgcc aggcagggct tgagaccggc       300
     gacgtcgatt gtgtcgtgac ggtctcctcc accggtttta cgacgccgag cctcgatgca       360
     cagcttgccg gccggatggg tttcagaccc gacatcgaac gcgttccggt cttcgggctt       420
     ggctgtgccg ccggcgtatc aggctttgcg atcgcctcgc ggctggcgcg aagccggccg       480
     ggcactgttg tgcttttcgt ctcgatcgaa ctttgcacgc tcgccttccg gctggacgag       540
     ctgacgcggc cgaacatcat cgcgacggcg cttttcggcg acggcgctgc cgcctgcgtg       600
     ctgcgatcag gcgaagacgg gctggcggag gtggaatcga ccggcgagca tctttttccc       660
     gacacgctcg atatcatggg ctggaagatc gatgacggcg gcttcggtat cgtgctggcg       720
     caatcgctgc cgccgtttgc cgaaaaggag cttggcccag cggtaacggc cattctggcg       780
     cgcaacgggc tgagggtgga ggatatagac cgcttcatct gccatcccgg cggcatgaag       840
     gtgctggctg cgatggagag cgcgctttcg atggtgccgg gcacgctcga tcacgaacgc       900
     gccgtgcttg ccgaatacgg caacatgtcc tcgccgacta tcctgttcgt gctggagcgg       960
     gcaatccgcg ccgggttgcc ggcgcgcgcc gcgatgatcg ccatgggtcc gggcttttcg      1020
     gcgagctgcg tgacgctcag gagggtcgca tga                                   1053
//

If you have problems or comments...

PBIL Back to PBIL home page