(data stored in ACNUC7421 zone)

EMBL: CP001622.PE429

CP001622.PE429       Location/Qualifiers
FT   CDS_pept        447553..448089
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0431"
FT                   /product="Tetratricopeptide domain protein"
FT                   /note="SMART: Tetratricopeptide domain protein; KEGG:
FT                   rec:RHECIAT_CH0000824 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0431"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54741"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="UniProtKB/TrEMBL:C6B1M2"
FT                   /inference="protein motif:SMART:SM00028"
FT                   /protein_id="ACS54741.1"
FT                   /translation="MTIMTARIASLLLGGCLAASVVSGPVFAIGDDSSTTPVCKKGEIY
FT                   DQKTKKCVKQQSANVSDENRADYAYSLAKAGRYEEALAVLDTVKDQNTAEVLNYRGYAT
FT                   RKLGRTDEGISYYLQSVKMDPQYAKVREYLGEAYVIKGQLDLAKDQLKTIKAICGTGCE
FT                   EYQDLNAVILDPSKI"
     atgacgatca tgacagcccg catcgcttcc ctccttctcg gcggctgcct cgccgcctct        60
     gttgtctccg gcccggtctt tgcgatcggc gatgatagca gcacgacacc ggtctgcaag       120
     aagggcgaga tctacgacca gaagaccaag aaatgcgtca agcagcagag cgccaacgtc       180
     tccgacgaga accgcgccga ctatgcctat tcgctggcca aggccggtcg ttatgaggag       240
     gcgcttgccg tgctcgacac ggtcaaggat cagaacaccg ccgaagtgct gaattaccgc       300
     ggttatgcca cccgcaagct tggccgcacc gacgagggca tctcctatta cctgcagtcg       360
     gtgaagatgg acccgcaata cgctaaggtc cgcgaatatc tcggcgaagc ctatgtcatc       420
     aagggtcagc tcgatctcgc caaggatcag ctgaagacca tcaaggcgat ctgcggtacc       480
     ggctgcgagg aatatcagga tctgaacgct gttatcctcg atccctcgaa gatctga          537
//

If you have problems or comments...

PBIL Back to PBIL home page