(data stored in ACNUC7421 zone)

EMBL: CP001622.PE43

CP001622.PE43        Location/Qualifiers
FT   CDS_pept        complement(38688..40268)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0044"
FT                   /product="integral membrane protein MviN"
FT                   /note="TIGRFAM: integral membrane protein MviN; PFAM:
FT                   virulence factor MVIN family protein; polysaccharide
FT                   biosynthesis protein; multi antimicrobial extrusion protein
FT                   MatE; KEGG: rec:RHECIAT_CH0000426 virulence factor
FT                   transmembrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0044"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54355"
FT                   /db_xref="GOA:C6AYD1"
FT                   /db_xref="InterPro:IPR004268"
FT                   /db_xref="UniProtKB/TrEMBL:C6AYD1"
FT                   /inference="protein motif:TFAM:TIGR01695"
FT                   /protein_id="ACS54355.1"
FT                   /translation="MSLVKKFATVGGATLGSRIFGFARETLMAAALGTGPMADVFYAAF
FT                   RFPNLFRRLFAEGAFNAAFVPLFAKEIEANGTDGAKRFSEEVFGVLFSVLLLITIVMEL
FT                   AMPLLVRFVIAPGFADDPEKFSITIRMAAVMFPYLMCMSLTAMMSGMLNSLHHFFAAAI
FT                   APVFLNVVMIGALFYALYTGADPLATAWYLSWGVLAAGVLQLAVVYVGVLAAGMSIGFR
FT                   FPKMTPNVKRLLILAVPAAVTGGITQINQLIGQAIASSRDGAIAALQYADRIYQLPLGV
FT                   VGVAVGVVLLPELARALKGGNLREAGNLQNRSIEFVLFLTIPAAFALWILSDEIIRVLY
FT                   ERGAFHQENTAVVGSILAIYGIGLPAFVLIKALQPGFYAREDTKTPMRFSAIAVATNCA
FT                   TALTLFPYMGAPGIAVAEATAGWISTVLLFATLLRRGHLTWEWALAKRTALLIVAAAVM
FT                   GAAIVFLKQYWAPSLASGAPLLTKIGTLGLLIAIAMLIYFAAAFLVGGANLGMIRRNLN
FT                   RKPAPAKDG"
     atgagcctcg tcaagaaatt cgcgaccgtc ggcggcgcca ccctcggcag ccgcattttc        60
     ggcttcgccc gtgaaacgtt gatggctgcg gccctcggca ccggaccgat ggccgacgtc       120
     ttctacgccg ccttccgctt tccgaatctc ttccgccggc tgtttgccga gggcgccttt       180
     aacgccgcct tcgtgccgct ctttgccaag gagatcgagg cgaacggcac ggatggcgcc       240
     aagcgctttt cggaagaggt cttcggcgtg ctattttcgg tgctgctcct catcaccatc       300
     gtgatggagc ttgccatgcc gctcttggtg cgcttcgtca tcgcgccggg ctttgccgac       360
     gatcccgaaa aattctcgat cacgatccgc atggcggcgg tgatgtttcc ctatctgatg       420
     tgcatgtcgc taacggcaat gatgagcggc atgctgaatt cgctgcatca tttcttcgcc       480
     gccgccatcg cgcccgtctt cctcaacgtg gtgatgatcg gggcgctgtt ttatgcgctc       540
     tataccggcg ccgatccgct ggcgaccgcc tggtatctct cctggggcgt tcttgccgcc       600
     ggcgtgctgc agcttgccgt cgtctatgtc ggcgtacttg cggccggtat gagcatcggc       660
     ttccgcttcc cgaagatgac gcccaatgtc aagcggctgc tgatcctggc ggtgccggct       720
     gcggtgaccg gcggcatcac ccagatcaat cagctgatcg gccaggcgat tgcgtcgtcc       780
     cgcgacggcg cgatcgcagc actgcaatat gccgaccgta tctatcagct gcccctcggg       840
     gtcgtcggcg tcgccgtcgg cgtggtgctt ctgccggaac tggcccgggc gctgaagggc       900
     ggcaacctgc gcgaggccgg gaacctgcag aaccgctcga tcgaattcgt gctgttcctg       960
     acgatccctg ccgccttcgc gctctggatc ctctccgacg agatcatccg cgtgctctac      1020
     gagcgcggcg ccttccatca ggaaaacacc gcggtcgtcg gctcgatcct ggcgatttac      1080
     ggcatcggcc tgccggcctt cgtgctgatc aaggcgctgc agcccggttt ctatgcccgc      1140
     gaggacacca agacgccgat gcgtttttcg gccatcgcgg ttgcgaccaa ctgcgccacg      1200
     gcgctcaccc tctttcccta tatgggcgcg cccggcatcg cggttgccga agccaccgcc      1260
     ggctggatca gcaccgtgct gctgttcgcc acacttttgc gccgcggcca cctgacatgg      1320
     gaatgggcgc tggcaaagcg cacggccctg ctgatcgtcg ccgcggccgt gatgggcgcg      1380
     gccatcgtct tcctcaagca atattgggcg ccatcgcttg cttccggcgc gccgcttctc      1440
     accaagatcg gcacccttgg gctgctgatt gcgatcgcca tgctgatcta tttcgccgcc      1500
     gccttcctgg ttggcggggc aaatctcggc atgatccgac gcaatctgaa ccgcaagccg      1560
     gcgccggcaa aggacggttg a                                                1581
//

If you have problems or comments...

PBIL Back to PBIL home page