(data stored in ACNUC7421 zone)

EMBL: CP001622.PE430

CP001622.PE430       Location/Qualifiers
FT   CDS_pept        448138..448743
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0432"
FT                   /product="RNA polymerase, sigma-24 subunit, ECF subfamily"
FT                   /note="TIGRFAM: RNA polymerase sigma factor, sigma-70
FT                   family; PFAM: Sigma-70 region 4 type 2; sigma-70 region 2
FT                   domain protein; sigma-70 region 4 domain protein; KEGG:
FT                   rec:RHECIAT_CH0000825 RNA polymerase sigma factor protein
FT                   (sigma-24)"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0432"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54742"
FT                   /db_xref="GOA:C6B1M3"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR013249"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039425"
FT                   /db_xref="UniProtKB/TrEMBL:C6B1M3"
FT                   /inference="protein motif:TFAM:TIGR02937"
FT                   /protein_id="ACS54742.1"
FT                   /translation="MSVARTHFPAYSHARMESPVHPAVSRDRGLAEAAIASEADIRSGL
FT                   TENLARLWRYGLVLSHQRDVADDLVQATCLRALERADQFIPGTRLDRWLFSILHSIWLN
FT                   EIRSRRVRQGQGFVDAGETLTFDGAHDTETQVMAHQVLKQVNALPEAQRTVVFLAYVEG
FT                   LSYREVAGILDIPIGTVMSRLAAARAKLSGAGPEGGRQ"
     atgtcggtcg cgcgcaccca ttttcctgcc tatagtcacg cgagaatgga atcgccggtt        60
     cacccggcgg tttcgaggga tagaggattg gcggaggcgg ccatcgcgag cgaagcggat       120
     atcaggagcg gcctgacgga aaatctggca aggctctggc gttatggtct cgttctctcg       180
     catcagcgcg atgtcgccga cgaccttgtg caggcgacct gccttcgcgc actggagcgc       240
     gccgatcagt tcatccccgg cacccggctc gaccgctggc tgttttcgat cctgcattcg       300
     atctggctga acgagatccg ctctcgccgg gtacgccagg gccagggttt cgtcgatgcc       360
     ggggagacgc tgaccttcga cggcgcgcac gacaccgaaa cgcaggtgat ggcccatcag       420
     gtgctgaaac aggtgaatgc gctgcctgaa gcgcagagga cggtggtttt cctcgcctat       480
     gtggagggac tttcctatcg cgaggttgca ggcatattgg atatcccgat cggaaccgtg       540
     atgagccggc tggcggctgc ccgcgccaag ctctccggcg ccggaccgga agggggacgg       600
     caatga                                                                  606
//

If you have problems or comments...

PBIL Back to PBIL home page