(data stored in ACNUC7421 zone)

EMBL: CP001622.PE431

CP001622.PE431       Location/Qualifiers
FT   CDS_pept        448740..449543
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0433"
FT                   /product="putative transmembrane anti-sigma factor"
FT                   /note="KEGG: rec:RHECIAT_CH0000826 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0433"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54743"
FT                   /db_xref="GOA:C6B1M4"
FT                   /db_xref="UniProtKB/TrEMBL:C6B1M4"
FT                   /inference="similar to AA sequence:KEGG:RHECIAT_CH0000826"
FT                   /protein_id="ACS54743.1"
FT                   /translation="MTTKHTIPSDEDLTAFIDGELTAEEAARIEAIVKEDESTAERLEF
FT                   LARASLPFKQAFAPLLAEAPREKLETMLAAIPPQQSAKSGPTPAFATRRRFLGALAASL
FT                   VAGIAIDRAVIGIGARFSAKDENSEWRAVVADYISLYSAETLAGPVPGREDQAAQLAGL
FT                   DEKLGLSLSPEAVSLPGIDFKRALLLQYDGKPLAQIAYLDPETGPMALCIVRSDAGPKA
FT                   PDLESRKGMNVAYWSNATHAFMLIGRIPVDRVQELAENARSRLSA"
     atgacgacga aacacaccat tccctccgac gaggacctga ccgccttcat tgacggtgaa        60
     ctgaccgccg aagaggctgc gcgcatcgag gccattgtga aggaagacga gagcaccgcc       120
     gagcggctgg aattcctggc gcgcgccagc ctgcccttca agcaagcctt cgccccgctg       180
     ctcgccgaag ccccgcgcga gaaactggag acgatgcttg ccgccatccc gccgcagcag       240
     agcgcaaaat ccggccccac gcccgcattc gccactcgtc gccgcttcct cggcgcgctc       300
     gccgcctcgc tggtcgccgg catcgccatc gaccgcgccg tcatcggcat cggagcacgc       360
     ttttcggcaa aggacgaaaa cagcgaatgg cgcgccgtgg tcgccgatta tatctcgctc       420
     tattccgccg aaacgctcgc cggccccgtc cctggcaggg aggaccaggc cgcccagctc       480
     gccggtcttg acgaaaagct cggcctgtcg ctctccccag aagccgtctc gctcccgggg       540
     atcgatttca aacgcgccct gctgctgcaa tatgacggca aaccgctcgc ccagatcgcc       600
     tacctcgacc ccgaaaccgg cccgatggcg ctctgcatcg tcaggtctga cgcgggaccg       660
     aaggcgccgg acctcgaaag ccgcaaaggt atgaatgttg cctactggtc gaacgcgacg       720
     cacgctttca tgctgattgg ccgcatcccc gtagaccgtg tgcaggaatt ggcggagaac       780
     gcccggagca ggctttcagc ctaa                                              804
//

If you have problems or comments...

PBIL Back to PBIL home page