(data stored in ACNUC7421 zone)

EMBL: CP001622.PE432

CP001622.PE432       Location/Qualifiers
FT   CDS_pept        complement(449572..450435)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0434"
FT                   /product="glucose-1-phosphate thymidylyltransferase"
FT                   /note="TIGRFAM: glucose-1-phosphate thymidylyltransferase;
FT                   PFAM: Nucleotidyl transferase; KEGG: atc:AGR_L_532
FT                   glucose-1-phosphate thymidylyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0434"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54744"
FT                   /db_xref="GOA:C6B1M5"
FT                   /db_xref="InterPro:IPR005835"
FT                   /db_xref="InterPro:IPR005907"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:C6B1M5"
FT                   /inference="protein motif:TFAM:TIGR01207"
FT                   /protein_id="ACS54744.1"
FT                   /translation="MKGIVLAGGSGSRLHPMTHAVSKQLLPIYDKPMIYYPLTTLMLAG
FT                   IREVLIISTPHDMPLFQRLLGDGSEWGMSLSYAVQPSPDGLAQAYIIGADFVAGGPSCL
FT                   ILGDNIYFGHGLPELLEEGVSKGDGATIFAYHVHDPERYGVVEFGSDMTAISIEEKPAK
FT                   PKSHWAVTGLYFYDADVVDIAANLKPSARGEYEITDVNKTYLERGKLRVSMMGRGYAWL
FT                   DTGTPESLLEAGGFVRTLEKRQGFKIACPEEIALAKGFITKERFAQIAAQAGKGDYGQY
FT                   LRGLVD"
     atgaaaggta ttgtgcttgc gggcgggagc ggcagtcgcc tgcacccgat gactcatgcg        60
     gtctcgaagc agttgcttcc gatctatgat aagccgatga tctactaccc gctgacgact       120
     ttgatgctgg ctggcatacg ggaagttttg atcatctcca cgccgcacga catgccgctt       180
     tttcagcgat tgctgggtga cggcagtgaa tggggcatgt ctctgagcta tgctgtccag       240
     ccaagtcccg atgggctggc ccaagcctac attatcggag cggacttcgt ggcgggcgga       300
     ccatcctgtc tgatcctcgg agacaatatc tacttcggcc acggccttcc agaactgctt       360
     gaagagggtg tatcgaaagg cgatggagcg acgatattcg cctatcacgt gcacgatccc       420
     gaacgttacg gcgtcgtcga attcggcagc gatatgactg caatctcaat cgaagaaaag       480
     ccggcaaagc ccaaatcgca ctgggctgtc accggccttt atttttacga tgctgatgtc       540
     gttgatatcg cagccaatct aaagccgtcg gcgcgcggcg aatacgagat caccgatgtc       600
     aacaagacat atctggagcg ggggaagctg cgtgtctcga tgatgggccg cggatatgcc       660
     tggcttgata ccggcacacc cgaaagtctg ctggaggccg gcgggttcgt ccgcacgctt       720
     gaaaaacgcc agggcttcaa aatcgcttgc ccggaggaaa ttgcgctggc gaaaggcttc       780
     atcacgaagg agcgcttcgc ccagattgcc gcccaagcgg gcaaaggcga ttatggccag       840
     tacttgcgtg gtctggtgga ttag                                              864
//

If you have problems or comments...

PBIL Back to PBIL home page