(data stored in ACNUC7421 zone)

EMBL: CP001622.PE433

CP001622.PE433       Location/Qualifiers
FT   CDS_pept        complement(450432..451325)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0435"
FT                   /product="dTDP-4-dehydrorhamnose reductase"
FT                   /EC_number="1.1.1.133"
FT                   /note="KEGG: atc:AGR_L_531 dTDP-4-dehydrorhamnose
FT                   reductase; TIGRFAM: dTDP-4-dehydrorhamnose reductase; PFAM:
FT                   dTDP-4-dehydrorhamnose reductase; NAD-dependent
FT                   epimerase/dehydratase"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0435"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54745"
FT                   /db_xref="GOA:C6B1M6"
FT                   /db_xref="InterPro:IPR005913"
FT                   /db_xref="InterPro:IPR029903"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C6B1M6"
FT                   /inference="protein motif:TFAM:TIGR01214"
FT                   /protein_id="ACS54745.1"
FT                   /translation="MRIAVTGKSGQVTSALQALNVPGIEIIAIGRPELDLLEPSMVSEI
FT                   IAKIKPDVVVSSAAYTAVDKAESDEAAAFAINRDGAKAIAAATAELSLPVIHLSTDYVF
FT                   DGDKPECYVESDPVGPVSVYGRSKLEGEYAVAAANENHVILRTAWVYSTFGHNFVITML
FT                   RLAETREELSVVSDQLGCPTSAGDIAGAIVKIAGRLSNDSTPDLRGVCHLAGSGETSCA
FT                   GFARYILSIHEEKTGRRVTVKDIATADYPTAAKRPANSRLCCDKLKSLYSVSMPEWRIS
FT                   ARAAVTKLLEEPKEAV"
     atgcgcatcg cggtaacagg caagagcggc caggtcacgt ctgcgctgca ggcgctgaat        60
     gtgccaggta tcgagatcat cgccatcggc aggcccgagc tggatttgct tgagccttcg       120
     atggtgagtg aaatcattgc gaaaattaag cccgacgtcg tcgtctcatc cgccgcctac       180
     acggccgttg acaaagccga aagcgacgag gcggcagctt tcgccatcaa tcgagacggc       240
     gcaaaagcca tcgccgcagc aacggccgag ctatcccttc ccgtcatcca tctttcgact       300
     gattatgttt tcgatggaga caagcccgaa tgctatgtcg agagcgaccc ggtcggaccg       360
     gtatccgtct atggcagatc gaagctcgag ggagaatatg cggtcgccgc ggcgaatgaa       420
     aaccatgtca tcctgcggac ggcctgggtc tactccacgt ttggccacaa cttcgtgata       480
     acgatgttga ggctcgcaga gacacgagaa gagctgagcg tcgtcagcga tcaactgggt       540
     tgcccgacct ccgccggcga catcgccggg gctatcgtca aaatagcagg caggctatca       600
     aacgattcca ccccggactt gcggggcgtt tgtcacttgg ccggcagcgg cgaaaccagc       660
     tgcgctgggt ttgcacgata tatattgtca attcatgagg aaaagaccgg caggcgcgtc       720
     accgtcaagg acattgcgac cgctgactat cccacagcag cgaaacggcc agccaattcc       780
     agactgtgtt gcgataagct gaagagcctt tatagcgtga gcatgccgga gtggcggata       840
     tcagcgcgcg ctgctgtgac aaagctcttg gaagagccga aggaggccgt atga             894
//

If you have problems or comments...

PBIL Back to PBIL home page