(data stored in ACNUC7421 zone)

EMBL: CP001622.PE434

CP001622.PE434       Location/Qualifiers
FT   CDS_pept        complement(452396..452962)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0437"
FT                   /product="dTDP-4-dehydrorhamnose 3,5-epimerase"
FT                   /EC_number="5.1.3.13"
FT                   /note="KEGG: atc:AGR_L_529 dTDP-4-dehydrorhamnose
FT                   3,5-epimerase; TIGRFAM: dTDP-4-dehydrorhamnose
FT                   3,5-epimerase; PFAM: dTDP-4-dehydrorhamnose 35-epimerase
FT                   related"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0437"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54746"
FT                   /db_xref="GOA:C6B1M7"
FT                   /db_xref="InterPro:IPR000888"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="UniProtKB/TrEMBL:C6B1M7"
FT                   /inference="protein motif:TFAM:TIGR01221"
FT                   /protein_id="ACS54746.1"
FT                   /translation="MYALKVEQLEIGDVKKVTPARFGDPRGYFSEVFKDFWFRTNVADV
FT                   SFVQDNESLSAQPGTVRGLHFQSPPFAQGKLVRCLRGALLDVAVDIRHGSPTYGKWVSA
FT                   ELSPENGSQLWVPAGFAHGFVTLEPDTIISYKVTALYSAEHDCGVRWNDAEIGIEWPQM
FT                   DGYVLSDKDNKQPRLSELPTYFQFS"
     atgtatgctt tgaaagtgga acaactggag atcggcgacg ttaagaaggt cacacctgcc        60
     aggttcggtg acccgagggg ctacttcagc gaagtcttca aagatttctg gttccgcacg       120
     aacgtggccg acgtttcttt cgtgcaggat aatgaatccc tttcagcgca accggggacc       180
     gtccggggac tccatttcca atcgcctcca ttcgcacaag gcaaacttgt acgctgcctg       240
     cgcggcgcgc tcctggatgt ggcggtcgat atcagacatg gctctccgac atatgggaag       300
     tgggtctcag cagaactgtc ccctgagaac ggctcgcaac tttgggtgcc ggccggattt       360
     gcgcatgggt tcgtaacttt ggagcctgat acgatcataa gctacaaggt cacagctctc       420
     tacagcgcgg agcatgactg tggcgtgcgg tggaacgacg ccgaaatcgg catcgagtgg       480
     ccgcagatgg atggctacgt tctttctgat aaggacaaca agcagccgcg gctttcggaa       540
     ctccccacat attttcaatt ttcgtga                                           567
//

If you have problems or comments...

PBIL Back to PBIL home page