(data stored in ACNUC7421 zone)

EMBL: CP001622.PE435

CP001622.PE435       Location/Qualifiers
FT   CDS_pept        complement(453209..454129)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rleg_0438"
FT                   /product="NAD-dependent epimerase/dehydratase"
FT                   /note="PFAM: NAD-dependent epimerase/dehydratase;
FT                   dTDP-4-dehydrorhamnose reductase; KEGG: ret:RHE_CH00763
FT                   GDP-L-fucose synthase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rleg_0438"
FT                   /db_xref="EnsemblGenomes-Tr:ACS54747"
FT                   /db_xref="GOA:C6B1M8"
FT                   /db_xref="InterPro:IPR001509"
FT                   /db_xref="InterPro:IPR028614"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C6B1M8"
FT                   /inference="protein motif:PFAM:PF01370"
FT                   /protein_id="ACS54747.1"
FT                   /translation="MNRDVKIYVAGHRGMVGSAIVRRLKAGGYTNIVTRSHAELDLVNQ
FT                   AAVAEFMKAERPDYIFMAAARVGGIHANNVYRAEFLYQNLMIETNVVHAAWQAGVERML
FT                   FLGSSCIYPRDCPQPIREEYLLTGPLEQTNEAYAIAKIAGVKLCESYNRQYGTRYVSGM
FT                   PTNLYGPNDNYDLDSSHVMPALIRKVHEAKIRGDRQLVVWGSGRPMREFLYVDDMADAC
FT                   VFLMEKEVSEGLINIGTGEDITIRELAETIMRVVGFTGEIVYDQTKPDGTPRKLMSVDR
FT                   LSALGWKATTSLGDGIARAYADFAS"
     atgaacagag acgtgaagat ctatgttgca ggccatcgag gcatggtggg gtcggccatt        60
     gtccggaggc tgaaggctgg cggctacacg aacatcgtta ccagaagcca cgccgagctg       120
     gatctcgtca atcaggcggc cgttgccgaa ttcatgaagg cggagcggcc ggactacatc       180
     ttcatggccg cggcaagggt tggcggcatc catgcaaata acgtttatcg tgctgagttc       240
     ctctaccaga atctgatgat cgagacgaat gttgttcatg ccgcctggca ggctggtgtg       300
     gaacgcatgc tttttcttgg ctcgagttgc atctacccac gcgactgccc tcagcccatt       360
     cgcgaggagt atttgctgac tggccccctg gagcagacga acgaggccta tgcgatcgcc       420
     aagatagcgg gcgtcaagct gtgcgagagc tacaatcggc aatatggaac ccgctatgtc       480
     tcggggatgc cgactaatct gtacgggccg aatgacaatt atgatttgga cagtagccat       540
     gtgatgccgg ccttgatcag aaaggtccat gaggccaaaa ttcgcggtga ccggcagttg       600
     gtcgtctggg gatccggtcg gccaatgcgt gagttcctgt atgtcgacga catggctgac       660
     gcctgcgttt ttttgatgga aaaggaggtc agcgaggggc tcatcaacat tgggacgggc       720
     gaagacatta ccatccgcga acttgccgaa accatcatga gggttgtcgg cttcacgggc       780
     gagattgttt acgaccagac gaagccggac ggaacgccgc gcaaactgat gagcgttgac       840
     cgtttgtcgg cacttggatg gaaggcgacc acatcacttg gcgatggtat tgcgcgagca       900
     tatgccgatt tcgcgtcgtg a                                                 921
//

If you have problems or comments...

PBIL Back to PBIL home page